Property Summary

NCBI Gene PubMed Count 23
PubMed Score 8.65
PubTator Score 10.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Congenital disorder of glycosylation type 2E 1 0.0 0.0
Disease Target Count P-value
psoriasis 6694 3.0e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Congenital disorder of glycosylation 54 5.13 2.6
Disease Target Count Z-score Confidence
Cutis Laxa 39 4.76 2.4
Menkes disease 19 4.125 2.1
protein-losing enteropathy 12 3.049 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 3.0e-04

Gene RIF (6)

AA Sequence

MDFSKFLADDFDVKEWINAAFRAGSKEAASGKADGHAATLVMKLQLFIQEVNHAVEETSHQALQNMPKVL      1 - 70
RDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQLAAESLQEADKWSTLSADIEE     71 - 140
TFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEALKNRLEALASPQIVAAFTSQAVDQSKVFVKV    141 - 210
FTEIDRMPQLLAYYYKCHKVQLLAAWQELCQSDLSLDRQLTGLYDALLGAWHTQIQWATQVFQKPHEVVM    211 - 280
VLLIQTLGALMPSLPSCLSNGVERAGPEQELTRLLEFYDATAHFAKGLEMALLPHLHEHNLVKVTELVDA    281 - 350
VYDPYKPYQLKYGDMEESNLLIQMSAVPLEHGEVIDCVQELSHSVNKLFGLASAAVDRCVRFTNGLGTCG    351 - 420
LLSALKSLFAKYVSDFTSTLQSIRKKCKLDHIPPNSLFQEDWTAFQNSIRIIATCGELLRHCGDFEQQLA    421 - 490
NRILSTAGKYLSDSCSPRSLAGFQESILTDKKNSAKNPWQEYNYLQKDNPAEYASLMEILYTLKEKGSSN    491 - 560
HNLLAAPRAALTRLNQQAHQLAFDSVFLRIKQQLLLISKMDSWNTAGIGETLTDELPAFSLTPLEYISNI    561 - 630
GQYIMSLPLNLEPFVTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDAILQI    631 - 700
PELSPHSAKQLATDIDYLINVMDALGLQPSRTLQHIVTLLKTRPEDYRQVSKGLPRRLATTVATMRSVNY    701 - 770
//

Text Mined References (25)

PMID Year Title