Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.09
PubTator Score 5.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.300 5.4e-06
astrocytic glioma -2.300 3.1e-03
Astrocytoma, Pilocytic -1.800 1.6e-07
atypical teratoid / rhabdoid tumor -1.900 6.5e-05
ependymoma -2.500 3.2e-03
gastric cancer 1.100 2.4e-04
glioblastoma -1.500 1.6e-06
hepatocellular carcinoma 1.100 2.0e-06
medulloblastoma -1.300 4.4e-04
medulloblastoma, large-cell -1.400 8.1e-05
oligodendroglioma -2.000 6.5e-03
osteosarcoma -1.202 4.6e-03
ovarian cancer 1.800 7.5e-04
Pick disease -1.100 5.0e-02
pituitary cancer -1.400 5.8e-05

 GO Function (1)

Gene RIF (3)

AA Sequence

MEERERGARSAGAGSPARPPSPRLDVSSDSFDPLLALYAPRLPPIPYPNAPCFNNVAEYESFLRTGVRGG      1 - 70
GRGRGRARGAAAGSGVPAAPGPSGRTRRRPDAPAPDPERIQRLRRLMVAKEEGDGAAGAGRRGPGRSRKA     71 - 140
PRNVLTRMPLHEGSPLGELHRCIREGVKVNVHIRTFKGLRGVCTGFLVAFDKFWNMALTDVDETYRKPVL    141 - 210
GKAYERDSSLTLTRLFDRLKLQDSSKKEADSKSAVEDSTLSRYSQTSTWKLASVWGRADTGRGSHKRSRS    211 - 280
VPSSLQASAREESRSELSGRTTRTDGSSVGGTFSRATTLSRGQSRKKKRKPKVDYQQVFTRHINQIFIRG    281 - 350
ENVLLVHLAQ                                                                351 - 360
//

Text Mined References (14)

PMID Year Title