Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.32
PubTator Score 5.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
pilocytic astrocytoma 3086 2.01713663624949E-7
hepatocellular carcinoma 550 1.97761096799675E-6
adult high grade glioma 2148 5.36584662219119E-6
glioblastoma 5572 5.96519210553551E-6
pituitary cancer 1972 5.82610521499184E-5
atypical teratoid / rhabdoid tumor 4369 6.52327932427747E-5
medulloblastoma, large-cell 6234 8.12734948290122E-5
gastric cancer 436 2.39892033080432E-4
medulloblastoma 1524 4.41824787377262E-4
ovarian cancer 8492 7.51824954729851E-4
astrocytic glioma 2241 0.00314083694226332
ependymoma 2514 0.00317026553192629
osteosarcoma 7933 0.00464901983695371
oligodendroglioma 2849 0.00650237665408683
Pick disease 1893 0.0498127846929379

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer 1.100 0.000
hepatocellular carcinoma 1.100 0.000
astrocytic glioma -2.300 0.003
ependymoma -2.500 0.003
oligodendroglioma -2.000 0.007
glioblastoma -2.100 0.000
osteosarcoma -1.202 0.005
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -1.400 0.000
adult high grade glioma -2.300 0.000
pilocytic astrocytoma -1.800 0.000
Pick disease -1.100 0.050
ovarian cancer 1.800 0.001
pituitary cancer -1.400 0.000

Synonym

Accession P83369 A0AVQ1 Q7Z7P0 Q8N975
Symbols

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GO Function (1)

Gene RIF (3)

PMID Text
23071092 FLASH/Lsm11 complex bind a unique combination of polyadenylation factors
16914750 The overexpression of Lsm10 and Lsm11 increases the cellular levels of U7 snRNP but has no effect on histone pre-mRNA processing.
16087681 Lsm10 and Lsm11, which replace the Sm proteins D1 and D2 in the histone RNA processing U7 snRNPs, associate with pICln in vitro and in vivo without receiving sDMA modifications and with PRMT5 and SMN complexes

AA Sequence

MEERERGARSAGAGSPARPPSPRLDVSSDSFDPLLALYAPRLPPIPYPNAPCFNNVAEYESFLRTGVRGG      1 - 70
GRGRGRARGAAAGSGVPAAPGPSGRTRRRPDAPAPDPERIQRLRRLMVAKEEGDGAAGAGRRGPGRSRKA     71 - 140
PRNVLTRMPLHEGSPLGELHRCIREGVKVNVHIRTFKGLRGVCTGFLVAFDKFWNMALTDVDETYRKPVL    141 - 210
GKAYERDSSLTLTRLFDRLKLQDSSKKEADSKSAVEDSTLSRYSQTSTWKLASVWGRADTGRGSHKRSRS    211 - 280
VPSSLQASAREESRSELSGRTTRTDGSSVGGTFSRATTLSRGQSRKKKRKPKVDYQQVFTRHINQIFIRG    281 - 350
ENVLLVHLAQ                                                                351 - 360
//

Text Mined References (13)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23071092 2013 A complex containing the CPSF73 endonuclease and other polyadenylation factors associates with U7 snRNP and is recruited to histone pre-mRNA for 3'-end processing.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18082603 2007 Purification of human telomerase complexes identifies factors involved in telomerase biogenesis and telomere length regulation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16914750 2006 ZFP100, a component of the active U7 snRNP limiting for histone pre-mRNA processing, is required for entry into S phase.
16714279 2006 Conserved zinc fingers mediate multiple functions of ZFP100, a U7snRNP associated protein.
16087681 2005 Toward an assembly line for U7 snRNPs: interactions of U7-specific Lsm proteins with PRMT5 and SMN complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...