Property Summary

NCBI Gene PubMed Count 21
PubMed Score 64.89
PubTator Score 18.66

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
26603571 MiR-125b-5p attenuates the secretion of MCP-1 by directly targeting inhibiting LACTB in LPS-stimulated THP-1 macrophages.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18538381 Observational study of gene-disease association. (HuGE Navigator)
12164938 Differential expression of a novel gene, G24, in response to hsp27 and cell differentiation in human keratinocytes.(G24 PROTEIN)

AA Sequence

MYRLMSAVTARAAAPGGLASSCGRRGVHQRAGLPPLGHGWVGGLGLGLGLALGVKLAGGLRGAAPAQSPA      1 - 70
APDPEASPLAEPPQEQSLAPWSPQTPAPPCSRCFARAIESSRDLLHRIKDEVGAPGIVVGVSVDGKEVWS     71 - 140
EGLGYADVENRVPCKPETVMRIASISKSLTMVALAKLWEAGKLDLDIPVQHYVPEFPEKEYEGEKVSVTT    141 - 210
RLLISHLSGIRHYEKDIKKVKEEKAYKALKMMKENVAFEQEKEGKSNEKNDFTKFKTEQENEAKCRNSKP    211 - 280
GKKKNDFEQGELYLREKFENSIESLRLFKNDPLFFKPGSQFLYSTFGYTLLAAIVERASGCKYLDYMQKI    281 - 350
FHDLDMLTTVQEENEPVIYNRARFYVYNKKKRLVNTPYVDNSYKWAGGGFLSTVGDLLKFGNAMLYGYQV    351 - 420
GLFKNSNENLLPGYLKPETMVMMWTPVPNTEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAV    421 - 490
GASSVLLVLPEELDTETINNKVPPRGIIVSIICNMQSVGLNSTALKIALEFDKDRSD                 491 - 547
//

Text Mined References (24)

PMID Year Title
26603571 2016 MicroRNA-125b-5p attenuates lipopolysaccharide-induced monocyte chemoattractant protein-1 production by targeting inhibiting LACTB in THP-1 macrophages.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
19858488 2009 LACTB is a filament-forming protein localized in mitochondria.
More...