Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.01
PubTator Score 5.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 5.3e-07
osteosarcoma 7950 5.2e-06
ovarian cancer 8520 7.0e-06
Disease Target Count Z-score Confidence
Pre-Eclampsia 68 4.045 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.122 5.2e-06
ovarian cancer -2.000 7.0e-06
tuberculosis -2.100 5.3e-07

Synonym

Accession P83105 Q542Z4 Q6PF13
Symbols

Gene

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

MIRPQLRTAGLGRCLLPGLLLLLVPVLWAGAEKLHTQPSCPAVCQPTRCPALPTCALGTTPVFDLCRCCR      1 - 70
VCPAAEREVCGGAQGQPCAPGLQCLQPLRPGFPSTCGCPTLGGAVCGSDRRTYPSMCALRAENRAARRLG     71 - 140
KVPAVPVQWGNCGDTGTRSAGPLRRNYNFIAAVVEKVAPSVVHVQLWGRLLHGSRLVPVYSGSGFIVSED    141 - 210
GLIITNAHVVRNQQWIEVVLQNGARYEAVVKDIDLKLDLAVIKIESNAELPVLMLGRSSDLRAGEFVVAL    211 - 280
GSPFSLQNTATAGIVSTKQRGGKELGMKDSDMDYVQIDATINYGNSGGPLVNLDGDVIGVNSLRVTDGIS    281 - 350
FAIPSDRVRQFLAEYHEHQMKGKAFSNKKYLGLQMLSLTVPLSEELKMHYPDFPDVSSGVYVCKVVEGTA    351 - 420
AQSSGLRDHDVIVNINGKPITTTTDVVKALDSDSLSMAVLRGKDNLLLTVIPETIN                  421 - 476
//

Text Mined References (12)

PMID Year Title