Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.62
PubTator Score 5.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.122 0.000
tuberculosis -2.100 0.000
ovarian cancer -2.000 0.000

Gene RIF (5)

PMID Text
25946029 HtrA4 represents a novel placenta-specific serine protease that is altered specifically in early-onset preeclampsia with potential causal roles in endothelial dysfunction and disease development.
25002585 Conditioned media from these two cell lines after decidualization treatment suppress HtrA4-expressing JAR cell invasion in an HtrA1- or HtrA3-dependent manner.
22964307 Data suggest that increased HtrA4 (and HtrA1) in placenta tissues may be involved in onset of pre-eclampsia; elevated level of HtrA4 (but not HtrA1) in sera has potential as biomarker for pre-eclampsia.
22778138 study reveals a novel function of GCM1 and HtrA4 in regulation of trophoblast invasion and that abnormal HrtA4 expression may contribute to shallow trophoblast invasion in preeclampsia
12408815 FLJ90724 or HTRA4 is a member of the HtrA family of proteases

AA Sequence

MIRPQLRTAGLGRCLLPGLLLLLVPVLWAGAEKLHTQPSCPAVCQPTRCPALPTCALGTTPVFDLCRCCR      1 - 70
VCPAAEREVCGGAQGQPCAPGLQCLQPLRPGFPSTCGCPTLGGAVCGSDRRTYPSMCALRAENRAARRLG     71 - 140
KVPAVPVQWGNCGDTGTRSAGPLRRNYNFIAAVVEKVAPSVVHVQLWGRLLHGSRLVPVYSGSGFIVSED    141 - 210
GLIITNAHVVRNQQWIEVVLQNGARYEAVVKDIDLKLDLAVIKIESNAELPVLMLGRSSDLRAGEFVVAL    211 - 280
GSPFSLQNTATAGIVSTKQRGGKELGMKDSDMDYVQIDATINYGNSGGPLVNLDGDVIGVNSLRVTDGIS    281 - 350
FAIPSDRVRQFLAEYHEHQMKGKAFSNKKYLGLQMLSLTVPLSEELKMHYPDFPDVSSGVYVCKVVEGTA    351 - 420
AQSSGLRDHDVIVNINGKPITTTTDVVKALDSDSLSMAVLRGKDNLLLTVIPETIN                  421 - 476
//

Text Mined References (11)

PMID Year Title
25946029 2015 Human HtrA4 Expression Is Restricted to the Placenta, Is Significantly Up-Regulated in Early-Onset Preeclampsia, and High Levels of HtrA4 Cause Endothelial Dysfunction.
25002585 2014 Functional antagonism between high temperature requirement protein A (HtrA) family members regulates trophoblast invasion.
22964307 2012 Upregulation of HtrA4 in the placentas of patients with severe pre-eclampsia.
22778138 2012 High-temperature requirement protein A4 (HtrA4) suppresses the fusogenic activity of syncytin-1 and promotes trophoblast invasion.
18387192 2008 A pathway sensor for genome-wide screens of intracellular proteolytic cleavage.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...