Property Summary

NCBI Gene PubMed Count 23
PubMed Score 7.90
PubTator Score 7.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -2.131 2.7e-11
Atopic dermatitis -1.400 9.2e-04
breast carcinoma -1.100 2.5e-05
colon cancer -3.300 1.1e-04
ductal carcinoma in situ -1.900 9.3e-04
fibroadenoma -1.300 2.0e-02
interstitial cystitis -1.900 8.0e-03
intraductal papillary-mucinous adenoma (... -3.400 2.3e-05
intraductal papillary-mucinous carcinoma... -3.700 1.6e-05
intraductal papillary-mucinous neoplasm ... -3.800 4.1e-04
invasive ductal carcinoma -1.700 1.8e-02
lung adenocarcinoma -1.800 1.8e-18
lung cancer -4.000 7.4e-07
non-small cell lung cancer -1.986 1.7e-20
osteosarcoma -1.659 4.6e-02
pancreatic cancer -1.100 5.4e-04
pancreatic ductal adenocarcinoma liver m... -1.355 7.9e-03
posterior fossa group A ependymoma 1.600 4.6e-07
psoriasis -1.400 6.5e-08

Gene RIF (8)

AA Sequence

MASWTSPWWVLIGMVFMHSPLPQTTAEKSPGAYFLPEFALSPQGSFLEDTTGEQFLTYRYDDQTSRNTRS      1 - 70
DEDKDGNWDAWGDWSDCSRTCGGGASYSLRRCLTGRNCEGQNIRYKTCSNHDCPPDAEDFRAQQCSAYND     71 - 140
VQYQGHYYEWLPRYNDPAAPCALKCHAQGQNLVVELAPKVLDGTRCNTDSLDMCISGICQAVGCDRQLGS    141 - 210
NAKEDNCGVCAGDGSTCRLVRGQSKSHVSPEKREENVIAVPLGSRSVRITVKGPAHLFIESKTLQGSKGE    211 - 280
HSFNSPGVFLVENTTVEFQRGSERQTFKIPGPLMADFIFKTRYTAAKDSVVQFFFYQPISHQWRQTDFFP    281 - 350
CTVTCGGGYQLNSAECVDIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLP    351 - 420
RWEHNPWTACSVSCGGGIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDCPKWIAMEWSQC    421 - 490
TVTCGRGLRYRVVLCINHRGEHVGGCNPQLKLHIKEECVIPIPCYKPKEKSPVEAKLPWLKQAQELEETR    491 - 560
IATEEPTFIPEPWSACSTTCGPGVQVREVKCRVLLTFTQTETELPEEECEGPKLPTERPCLLEACDESPA    561 - 630
SRELDIPLPEDSETTYDWEYAGFTPCTATCVGGHQEAIAVCLHIQTQQTVNDSLCDMVHRPPAMSQACNT    631 - 700
EPCPPRWHVGSWGPCSATCGVGIQTRDVYCLHPGETPAPPEECRDEKPHALQACNQFDCPPGWHIEEWQQ    701 - 770
CSRTCGGGTQNRRVTCRQLLTDGSFLNLSDELCQGPKASSHKSCARTDCPPHLAVGDWSKCSVSCGVGIQ    771 - 840
RRKQVCQRLAAKGRRIPLSEMMCRDLPGLPLVRSCQMPECSKIKSEMKTKLGEQGPQILSVQRVYIQTRE    841 - 910
EKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGRCLQNSKRLGITKSGSLKIHGLAAPDIGVY    911 - 980
RCIAGSAQETVVLKLIGTDNRLIARPALREPMREYPGMDHSEANSLGVTWHKMRQMWNNKNDLYLDDDHI    981 - 1050
SNQPFLRALLGHCSNSAGSTNSWELKNKQFEAAVKQGAYSMDTAQFDELIRNMSQLMETGEVSDDLASQL   1051 - 1120
IYQLVAELAKAQPTHMQWRGIQEETPPAAQLRGETGSVSQSSHAKNSGKLTFKPKGPVLMRQSQPPSISF   1121 - 1190
NKTINSRIGNTVYITKRTEVINILCDLITPSEATYTWTKDGTLLQPSVKIILDGTGKIQIQNPTRKEQGI   1191 - 1260
YECSVANHLGSDVESSSVLYAEAPVILSVERNITKPEHNHLSVVVGGIVEAALGANVTIRCPVKGVPQPN   1261 - 1330
ITWLKRGGSLSGNVSLLFNGSLLLQNVSLENEGTYVCIATNALGKAVATSVLHLLERRWPESRIVFLQGH   1331 - 1400
KKYILQATNTRTNSNDPTGEPPPQEPFWEPGNWSHCSATCGHLGARIQRPQCVMANGQEVSEALCDHLQK   1401 - 1470
PLAGFEPCNIRDCPARWFTSVWSQCSVSCGEGYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGRKPCF   1471 - 1540
GHPCVQWEPGNRCPGRCMGRAVRMQQRHTACQHNSSDSNCDDRKRPTLRRNCTSGACDVCWHTGPWKPCT   1541 - 1610
AACGRGFQSRKVDCIHTRSCKPVAKRHCVQKKKPISWRHCLGPSCDRDCTDTTHYCMFVKHLNLCSLDRY   1611 - 1680
KQRCCQSCQEG                                                              1681 - 1691
//

Text Mined References (25)

PMID Year Title