Property Summary

NCBI Gene PubMed Count 10
Grant Count 17
R01 Count 17
Funding $1,472,616.75
PubMed Score 8.17
PubTator Score 5.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.513 0.010
diabetes mellitus 1.300 0.003
interstitial cystitis 1.700 0.000

Gene RIF (1)

PMID Text
17497168 Our study revealed that RBP5 down-regulation in HCC was associated with aggressive tumor features, suggesting an

AA Sequence

MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVE      1 - 70
FEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR          71 - 135
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17497168 2007 Down-regulation of retinol binding protein 5 is associated with aggressive tumor features in hepatocellular carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12479570 2002 Evolution of the family of intracellular lipid binding proteins in vertebrates.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11274389 2001 Identification, retinoid binding, and x-ray analysis of a human retinol-binding protein.
More...