Property Summary

NCBI Gene PubMed Count 20
PubMed Score 79.80
PubTator Score 33.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.603 0.000

Synonym

Accession P82979 A8K393 Q9P066
Symbols HCC1
THO1
CIP29
HSPC316

Gene

PDB

2DO1  

Gene RIF (4)

PMID Text
25496916 SAP domain containing ribonucleoprotein (SARNP) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
17196963 CIP29 physically and functionally associates with DDX39, suggesting their cooperation in the RNA metabolism.
15338056 Hcc-1 plays a role in growth regulation and nucleic acids metabolism.
11922608 CIP29 appears to be a new cytokine regulated protein involved in normal and cancer cell proliferation.

AA Sequence

MATETVELHKLKLAELKQECLARGLETKGIKQDLIHRLQAYLEEHAEEEANEEDVLGDETEEEETKPIEL      1 - 70
PVKEEEPPEKTVDVAAEKKVVKITSEIPQTERMQKRAERFNVPVSLESKKAARAARFGISSVPTKGLSSD     71 - 140
NKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTGTTEDTEAKKRKRAERFGIA    141 - 210
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
20844015 2010 ATP is required for interactions between UAP56 and two conserved mRNA export proteins, Aly and CIP29, to assemble the TREX complex.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17196963 2007 Intracellular characterization of DDX39, a novel growth-associated RNA helicase.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15635413 2005 Nucleolar proteome dynamics.
More...