Property Summary

NCBI Gene PubMed Count 28
PubMed Score 33.75
PubTator Score 25.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
active ulcerative colitis -1.086 1.1e-02
cystic fibrosis 1.783 2.0e-05
group 3 medulloblastoma 1.100 7.5e-03
lung cancer -1.400 8.9e-04
medulloblastoma, large-cell 1.600 2.1e-02
osteosarcoma 1.264 9.1e-03
psoriasis 1.700 2.0e-04

Gene RIF (19)

AA Sequence

MPKRKAAGQGDMRQEPKRRSARLSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSAQAVAETKQEA      1 - 70
VVEEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVAAEVKNEEEDQKEDEEDQNEE     71 - 140
KGEAGKEDKDEKGEEDGKEDKNGNEKGEDAKEKEDGKKGEDGKGNGEDGKEKGEDEKEEEDRKETGDGKE    141 - 210
NEDGKEKGDKKEGKDVKVKEDEKEREDGKEDEGGNEEEAGKEKEDLKEEEEGKEEDEIKEDDGKKEEPQS    211 - 280
IV                                                                        281 - 282
//

Text Mined References (37)

PMID Year Title