Property Summary

NCBI Gene PubMed Count 28
Grant Count 20
Funding $2,204,013.78
PubMed Score 31.36
PubTator Score 25.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 1.700 0.000
osteosarcoma 1.264 0.009
cystic fibrosis 1.783 0.000
medulloblastoma, large-cell 1.600 0.021
lung cancer -1.400 0.001
active ulcerative colitis -1.086 0.011
group 3 medulloblastoma 1.300 0.017

Gene RIF (19)

PMID Text
26548724 NSBP1 was highly expressed in NSCLC cells. NSBP1 siRNA knockdown suppressed NSCLC cell proliferation and invasion. miR326 has a putative binding site in the NSBP1 3'UTR. NSBP1 overexpression abolished miR326 inhibition of cyclin B1 and MMP9 expression.
26394192 Decreased miR-340 expression may contribute to the development and progression of prostate cancer through a mechanism that involves HMGN5.
26315299 HMGN5 overexpression is correlated with advanced pathological grade and poorer prognosis in meningiomas
26290438 Our data first time identified miR-186 as the upstream regulator of NSBP1
25796505 High HMGN5 expression is associated with urothelial bladder cancer.
25572120 HMGN5 is an oncogene and plays an important role in prostate cancer tumorigenesis and progression. the level of HMGN5 may be used as a biomarker to predict the patients that would benefit from gemcitabine treatment.
25315189 HMGN5 plays an oncogenic role in human breast cancer by inhibiting cell proliferation and invasion, and activating apoptosis, which could be exploited as a target for therapy in human breast cancer.
25307178 HMGN5 knockdown sensitizes prostate cancer cells to ionizing radiation
24687550 HMGN5 plays oncogenic role in osteosarcoma by promoting cell proliferation and invasion, and could be exploited as a target for therapy in osteosarcoma.
24664583 HMGN5 is a critical factor in the development of chemoresistance through regulating autophagy, and it offers a novel target for improving osteosarcoma therapy.
More...

AA Sequence

MPKRKAAGQGDMRQEPKRRSARLSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSAQAVAETKQEA      1 - 70
VVEEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVAAEVKNEEEDQKEDEEDQNEE     71 - 140
KGEAGKEDKDEKGEEDGKEDKNGNEKGEDAKEKEDGKKGEDGKGNGEDGKEKGEDEKEEEDRKETGDGKE    141 - 210
NEDGKEKGDKKEGKDVKVKEDEKEREDGKEDEGGNEEEAGKEKEDLKEEEEGKEEDEIKEDDGKKEEPQS    211 - 280
IV                                                                        281 - 282
//

Text Mined References (36)

PMID Year Title
26548724 2016 Suppression of nucleosome-binding protein 1 by miR-326 impedes cell proliferation and invasion in non-small cell lung cancer cells.
26394192 2016 microRNA-340 Suppresses Tumorigenic Potential of Prostate Cancer Cells by Targeting High-Mobility Group Nucleosome-Binding Domain 5.
26315299 2015 HMGN5 blockade by siRNA enhances apoptosis, suppresses invasion and increases chemosensitivity to temozolomide in meningiomas.
26290438 2015 MiR-186 suppresses the growth and metastasis of bladder cancer by targeting NSBP1.
25796505 2015 Knockdown of HMGN5 suppresses the viability and invasion of human urothelial bladder cancer 5637 cells in vitro and in vivo.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25572120 2015 Expression of oncogenic HMGN5 increases the sensitivity of prostate cancer cells to gemcitabine.
25315189 2015 The high-mobility group nucleosome-binding domain 5 is highly expressed in breast cancer and promotes the proliferation and invasion of breast cancer cells.
25307178 2015 HMGN5 knockdown sensitizes prostate cancer cells to ionizing radiation.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
More...