Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1.21
PubTator Score 1.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Synonym

Accession P82932 B2R573 Q96Q64 Q9BSK8 Q9BW89 MRP-S6
Symbols S6mt
RPMS6
MRP-S6
C21orf101

Gene

PDB

3J9M  

Gene RIF (5)

PMID Text
20971364 Observational study of gene-disease association. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
20738937 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19198609 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYA      1 - 70
PTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK                    71 - 125
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
21269460 2011 Initial characterization of the human central proteome.
20971364 2010 A multilocus genetic risk score for coronary heart disease: case-control and prospective cohort analyses.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20738937 2010 Additive effect of multiple genetic variants on the risk of coronary artery disease.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19198609 2009 Genome-wide association of early-onset myocardial infarction with single nucleotide polymorphisms and copy number variants.
More...