1. Home
  2. Targets
  3. 28S ribosomal protein S6, mitochondrial

Tdark 28S ribosomal protein S6, mitochondrial

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S6P family. Pseudogenes corresponding to this gene are found on chromosomes 1p and 12q. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1.21
PubTator Score 1.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Synonym

Accession P82932 B2R573 Q96Q64 Q9BSK8 Q9BW89 MRP-S6
Symbols S6mt
RPMS6
MRP-S6
C21orf101

Gene

MRPS6

PDB

3J9M  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (6)

 GO Function (2)

 GO Component (3)

 GO Process (4)

 Compartment GO Term (40)

See all...

 HCA RNA Cell Line (56)

See all...

Pathway (7)

Protein-protein Interaction (64)

MRPS12   MRPS14   MRPL33   DAP3   MRPS22   MRPS25   MRPS10   MRPS35   MRPS36   MRPS11   MRPS15   MRPS21   MRPS34   MRPS9   MRPL23   MRPL51   MRPL2   MRPL54   MRPL14   MRPL21   MRPL55   MRPL10   MRPL52   MRPL41   MRPL50   MRPL43   GADD45GIP1   MRPL30   MRPS27   MRPS31   MRPL24   CHCHD1   MRPL38   MRRF   MRPS24   MRPL53   PTCD3   MRPL48   MRPL57   MRPL45   MRPL20   MRPL4   MRPL1   MRPS26   MRPL37   MRPL18   MTIF3   MRPL46   MRPL44   MRPL47   MRPS30   MRPL17   AURKAIP1   MRPL22   MRPL16   MRPL35   MRPL15   MTRF1L   MRPS33   MRPS28   MRPS17   MRPS7   MRPS16   MRPL42  

Gene RIF (5)

PMID Text
20971364 Observational study of gene-disease association. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
20738937 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19198609 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence 

MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYA      1 - 70
PTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK                    71 - 125
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
21269460 2011 Initial characterization of the human central proteome.
20971364 2010 A multilocus genetic risk score for coronary heart disease: case-control and prospective cohort analyses.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20738937 2010 Additive effect of multiple genetic variants on the risk of coronary artery disease.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19198609 2009 Genome-wide association of early-onset myocardial infarction with single nucleotide polymorphisms and copy number variants.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036297 2002 Nineteen additional unpredicted transcripts from human chromosome 21.
11543634 2001 The human mitochondrial ribosomal protein genes: mapping of 54 genes to the chromosomes and implications for human disorders.
11402041 2001 Proteomic analysis of the mammalian mitochondrial ribosome. Identification of protein components in the 28 S small subunit.
11279123 2001 The small subunit of the mammalian mitochondrial ribosome. Identification of the full complement of ribosomal proteins present.
10830953 2000 The DNA sequence of human chromosome 21.