Property Summary

NCBI Gene PubMed Count 19
PubMed Score 1.21
PubTator Score 1.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Coronary artery disease 268 0.0 0.0

Expression

Synonym

Accession P82932 B2R573 Q96Q64 Q9BSK8 Q9BW89 MRP-S6
Symbols S6mt
RPMS6
MRP-S6
C21orf101

Gene

PDB

3J9M  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYA      1 - 70
PTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK                    71 - 125
//

Text Mined References (21)

PMID Year Title