Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.77
PubTator Score 0.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Brain glioma 10 4.033 2.0
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 0.000

Synonym

Accession P82930 Q9BVI7 MRP-S34
Symbols MRPS12
MRP-S12
MRP-S34

Gene

PDB

3J9M  

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MARKKVRPRLIAELARRVRALREQLNRPRDSQLYAVDYETLTRPFSGRRLPVRAWADVRRESRLLQLLGR      1 - 70
LPLFGLGRLVTRKSWLWQHDEPCYWRLTRVRPDYTAQNLDHGKAWGILTFKGKTESEAREIEHVMYHDWR     71 - 140
LVPKHEEEAFTAFTPAPEDSLASVPYPPLLRAMIIAERQKNGDTSTEEPMLNVQRIRMEPWDYPAKQEDK    141 - 210
GRAKGTPV                                                                  211 - 218
//

Text Mined References (11)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
12507520 2003 Binding of the human homolog of the Drosophila discs large tumor suppressor protein to the mitochondrial ribosomal protein MRP-S34.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11279123 2001 The small subunit of the mammalian mitochondrial ribosome. Identification of the full complement of ribosomal proteins present.
More...