1. Home
  2. Targets
  3. 28S ribosomal protein S34, mitochondrial

Tdark 28S ribosomal protein S34, mitochondrial

Required for mitochondrial translation, plays a role in maintaining the stability of the small ribosomal subunit and the 12S rRNA that are required for mitoribosome formation.

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

 Comments

Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.77
PubTator Score 0.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 2.0e-04
Disease Target Count Z-score Confidence
Brain glioma 10 4.033 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 2.0e-04

Synonym

Accession P82930 Q9BVI7 MRP-S34
Symbols MRPS12
MRP-S12
MRP-S34

Gene

MRPS34

PDB

3J9M  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (7)

 GO Function (1)

 GO Component (3)

 GO Process (3)

 Compartment GO Term (32)

See all...

 MGI Phenotype (5)

 HCA RNA Cell Line (56)

See all...

Pathway (6)

Protein-protein Interaction (85)

MRPS14   MRPL33   MRPS35   MRPS36   MRPL23   MRPL51   MRPL2   MRPL54   MRPL14   MRPL21   MRPL55   MRPL10   MRPL52   MRPL41   MRPL50   MRPL43   GADD45GIP1   MRPL30   MRPL24   CHCHD1   MRPL38   MRRF   MRPS24   MRPL53   PTCD3   MRPL48   MRPL57   MRPL45   MRPL20   MRPL4   MRPL1   MRPL37   MRPL18   MTIF3   MRPL46   MRPL44   MRPL47   MRPL17   AURKAIP1   MRPL22   MRPL16   MRPL35   MRPL15   MTRF1L   MRPS7   MRPS9   MRPS26   ZNF574   IGF2BP3   IGF2BP1   MRPS23   HIST1H1A   MRPS27   MRPS6   MRPS18B   DAP3   MRPS10   ZZEF1   NOA1   PREPL   EPDR1   MRPS28   DDX55   MRPS31   MRPS18C   MRPS5   MRPS22   GNL2   MRPS15   MRPS25   NINL   MRPS2   HECTD3   MRPS33   SUPV3L1   ZNF770   FAM192A   PSME3   FAM92A   MCAT   MRPS16   PSMG3   PDF   PSMG4   MRPS21  

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence 

MARKKVRPRLIAELARRVRALREQLNRPRDSQLYAVDYETLTRPFSGRRLPVRAWADVRRESRLLQLLGR      1 - 70
LPLFGLGRLVTRKSWLWQHDEPCYWRLTRVRPDYTAQNLDHGKAWGILTFKGKTESEAREIEHVMYHDWR     71 - 140
LVPKHEEEAFTAFTPAPEDSLASVPYPPLLRAMIIAERQKNGDTSTEEPMLNVQRIRMEPWDYPAKQEDK    141 - 210
GRAKGTPV                                                                  211 - 218
//

Text Mined References (11)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
12507520 2003 Binding of the human homolog of the Drosophila discs large tumor suppressor protein to the mitochondrial ribosomal protein MRP-S34.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11279123 2001 The small subunit of the mammalian mitochondrial ribosome. Identification of the full complement of ribosomal proteins present.
10751423 2000 Mammalian mitochondrial ribosomal proteins (4). Amino acid sequencing, characterization, and identification of corresponding gene sequences.