Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.2e-03

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCRRRQRESYERCRRIYNMEMAR      1 - 70
KINFLMRKNRADPWQGC                                                          71 - 87
//

Text Mined References (16)

PMID Year Title