Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.15
PubTator Score 30.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3232 6.1e-07
non primary Sjogren syndrome sicca 891 1.8e-02

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.500 6.1e-07
non primary Sjogren syndrome sicca 1.200 1.8e-02

Gene RIF (2)

AA Sequence

MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEE      1 - 70
SSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFRNAKKGTGIAAQTAGIAAAARAK     71 - 140
QKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL                    141 - 194
//

Text Mined References (17)

PMID Year Title