Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.15
PubTator Score 30.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
non primary Sjogren syndrome sicca 1.200 0.018

Synonym

Accession P82912 B2RD52 Q969D7 Q96GI3 Q9BYC3 MRP-S11
Symbols HCC-2
S11mt
MRP-S11

Gene

PDB

3J9M  

Gene RIF (2)

PMID Text
26125709 The downregulated gene with the largest effect size in ankylosing spondylitis was mitochondrial ribosomal protein S11 (MRPS11). (Meta-analysis)
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEE      1 - 70
SSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFRNAKKGTGIAAQTAGIAAAARAK     71 - 140
QKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL                    141 - 194
//

Text Mined References (16)

PMID Year Title
26125709 2015 Meta-analysis of differentially expressed genes in ankylosing spondylitis.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21531335 2011 MTERF4 regulates translation by targeting the methyltransferase NSUN4 to the mammalian mitochondrial ribosome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15300802 2004 ZNF143 activates gene expression in response to DNA damage and binds to cisplatin-modified DNA.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...