Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.86
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma -1.100 4.9e-02
interstitial lung disease 1.500 9.8e-03
intraductal papillary-mucinous adenoma (... 1.600 1.1e-03
intraductal papillary-mucinous carcinoma... 1.500 8.8e-03
osteosarcoma -1.330 2.4e-04
ovarian cancer 1.500 8.1e-07

Protein-protein Interaction (8)

Gene RIF (1)

AA Sequence

MATAVRAVGCLPVLCSGTAGHLLGRQCSLNTLPAASILAWKSVLGNGHLSSLGTRDTHPYASLSRALQTQ      1 - 70
CCISSPSHLMSQQYRPYSFFTKLTADELWKGALAETGAGAKKGRGKRTKKKKRKDLNRGQIIGEGRYGFL     71 - 140
WPGLNVPLMKNGAVQTIAQRSKEEQEKVEADMIQQREEWDRKKKMKVKRERGWSGNSWGGISLGPPDPGP    141 - 210
CGETYEDFDTRILEVRNVFTMTAKEGRKKSIRVLVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLH    211 - 280
YIERYEDHTIFHDISLRFKRTHIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVSGSINMLSLTQGLF    281 - 350
RGLSRQETHQQLADKKGLHVVEIREECGPLPIVVASPRGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRS    351 - 420
VWSNLKRAAT                                                                421 - 430
//

Text Mined References (16)

PMID Year Title