Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 0.42

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MAAAALPAWLSLQSRARTLRAFSTAVYSATPVPTPSLPERTPGNERPPRRKALPPRTEKMAVDQDWPSVY      1 - 70
PVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSD     71 - 140
EKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDVLTIKTD    141 - 210
RCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINK    211 - 280
EELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVKRLLNVT                               281 - 323
//

Text Mined References (16)

PMID Year Title