Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 0.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 3.81053338883271E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00536679915167093
lung cancer 4473 0.0079522658774269
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0155771873569227
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0331358608115503
esophageal adenocarcinoma 737 0.0400897597237058

Expression

Synonym

Accession P82673 Q32LZ1 Q6P4C6 Q7L1M6 Q8NBP4 Q96AI0 Q9H044 Q9HC14 Q9P1R5 MRP-S35
Symbols MDS023
MRPS28
MRP-S28
HDCMD11P

Gene

PDB

3J9M  

  Ortholog (11)

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAAALPAWLSLQSRARTLRAFSTAVYSATPVPTPSLPERTPGNERPPRRKALPPRTEKMAVDQDWPSVY      1 - 70
PVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSD     71 - 140
EKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDVLTIKTD    141 - 210
RCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINK    211 - 280
EELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVKRLLNVT                               281 - 323
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15300802 2004 ZNF143 activates gene expression in response to DNA damage and binds to cisplatin-modified DNA.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...