| Tdark | 28S ribosomal protein S35, mitochondrial |
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that has had confusing nomenclature in the literature. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. Pseudogenes corresponding to this gene are found on chromosomes 3p, 5q, and 10q. [provided by RefSeq, Jul 2010]
Comments
| Disease | log2 FC | p |
|---|---|---|
| esophageal adenocarcinoma | 1.100 | 0.040 |
| intraductal papillary-mucinous adenoma (... | 1.200 | 0.005 |
| intraductal papillary-mucinous carcinoma... | 1.100 | 0.016 |
| intraductal papillary-mucinous neoplasm ... | 1.200 | 0.033 |
| lung cancer | 1.100 | 0.008 |
| ovarian cancer | 1.800 | 0.000 |
MAAAALPAWLSLQSRARTLRAFSTAVYSATPVPTPSLPERTPGNERPPRRKALPPRTEKMAVDQDWPSVY 1 - 70 PVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSD 71 - 140 EKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDVLTIKTD 141 - 210 RCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINK 211 - 280 EELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVKRLLNVT 281 - 323 //
| PMID | Year | Title |
|---|---|---|
| 25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
| 22681889 | 2012 | The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts. |
| 21269460 | 2011 | Initial characterization of the human central proteome. |
| 20877624 | 2010 | Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression. |
| 17974005 | 2007 | The full-ORF clone resource of the German cDNA Consortium. |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. |
| 16303743 | 2005 | Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
| 15300802 | 2004 | ZNF143 activates gene expression in response to DNA damage and binds to cisplatin-modified DNA. |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. |
| More... |
