Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.200 4.5e-03
atypical teratoid / rhabdoid tumor -1.800 1.0e-05
Breast cancer 2.400 2.8e-02
ependymoma 1.100 4.3e-02
gastric cancer 1.100 8.0e-03
glioblastoma -2.100 1.0e-05
group 3 medulloblastoma 1.200 2.3e-02
intraductal papillary-mucinous adenoma (... 1.200 3.0e-03
intraductal papillary-mucinous carcinoma... 1.100 1.7e-02
intraductal papillary-mucinous neoplasm ... 1.600 5.6e-03
medulloblastoma, large-cell -1.600 1.8e-05
oligodendroglioma 1.100 3.3e-02
osteosarcoma -4.026 2.2e-10
ovarian cancer -1.100 3.0e-04
Pick disease -1.700 1.0e-05
progressive supranuclear palsy -1.500 9.6e-03

Gene RIF (1)

AA Sequence

MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNM      1 - 70
TPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECI     71 - 140
CEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD                                         141 - 173
//

Text Mined References (18)

PMID Year Title