Property Summary

NCBI Gene PubMed Count 17
Grant Count 1
R01 Count 1
Funding $65,543.8
PubMed Score 115.87
PubTator Score 24.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.119 0.003
pancreatic ductal adenocarcinoma liver m... -1.136 0.027
ovarian cancer 1.900 0.000

Synonym

Accession P82650 Q9H3I1 MRP-S22
Symbols GIBT
GK002
C3orf5
COXPD5
RPMS22
MRP-S22

Gene

 Grant Application (1)

PDB

3J9M  

Gene RIF (3)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
18539099 The effect of mutated MRPS22 on the assembly of the small and large ribosomal subunits in human mitochondria is reported.
17873122 A mutation in the MRPS22 gene led to reduction of 12sRNA in fibroblasts and fatal neonatal hypertrophic cardiomyopathy & kidney tubulopathy.

AA Sequence

MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTF      1 - 70
MDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPIND     71 - 140
VLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIF    141 - 210
KEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKK    211 - 280
IDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQ    281 - 350
EALSRHSAAS                                                                351 - 360
//

Text Mined References (22)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22013104 2012 Genome-wide scan for loci of adolescent obesity and their relationship with blood pressure.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18539099 2008 The effect of mutated mitochondrial ribosomal proteins S16 and S22 on the assembly of the small and large ribosomal subunits in human mitochondria.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17873122 2007 Antenatal mitochondrial disease caused by mitochondrial ribosomal protein (MRPS22) mutation.
More...