Property Summary

NCBI Gene PubMed Count 56
PubMed Score 182.44
PubTator Score 213.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver neoplasms 130 0.0 0.0
Disease Target Count P-value
fibroadenoma 559 4.7e-03
psoriasis 6694 1.8e-02
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 2.4

Expression

  Differential Expression (2)

Disease log2 FC p
fibroadenoma 1.800 4.7e-03
psoriasis -2.500 1.8e-02

Gene RIF (35)

AA Sequence

MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGL      1 - 70
DGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL                                   71 - 110
//

Text Mined References (61)

PMID Year Title