Property Summary

NCBI Gene PubMed Count 53
Grant Count 83
R01 Count 33
Funding $25,998,399.67
PubMed Score 176.93
PubTator Score 213.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
fibroadenoma 1.800 0.005
psoriasis -3.700 0.000

Synonym

Accession P81605 A5JHP2 A5JHP3 P58461 Q53YJ2
Symbols PIF
AIDD
DSEP
HCAP
DCD-1

Gene

DCD

PDB

2KSG   2YMK  

Gene RIF (32)

PMID Text
25879571 These findings imply that DCD promotes breast tumorigenesis via modulation of ERBB signaling pathways
25673161 Reduced DCD concentration in sweat in patients with inflammatory acne may permit proliferation of P. acnes in pilosebaceous units, resulting in progression of inflammatory acne.
25055737 Dermcidin binds platelets and may inhibit the therapeutic action of aspirin following acute myocardial infarction.
24969620 Data indicate that Y-P30/dermcidin expressed in placentas of first trimester pregnancies.
24562771 Increased Dermcidin was also detected with immunoblotting.
23426625 Crystal structure and functional mechanism of a human antimicrobial membrane channel
22588119 major binding partners of LEKTI were found to be the antimicrobial peptide dermcidin and the serine protease cathepsin G and no kallikreins.
22262861 Structure-activity analysis of the dermcidin-derived peptide DCD-1L, an anionic antimicrobial peptide present in human sweat.
21397687 revealed that Nck1 SH2 domain binds to the phosphotyrosine residue at position 20 (Y20) of the DCD
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGL      1 - 70
DGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL                                   71 - 110
//

Text Mined References (58)

PMID Year Title
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25879571 2015 Dermcidin exerts its oncogenic effects in breast cancer via modulation of ERBB signaling.
25673161 2015 Reduced expression of dermcidin, a peptide active against propionibacterium acnes, in sweat of patients with acne vulgaris.
25416956 2014 A proteome-scale map of the human interactome network.
25055737 2014 Dermcidin isoform-2 induced nullification of the effect of acetyl salicylic acid in platelet aggregation in acute myocardial infarction.
24969620 2014 Analysis of Y-P30/Dermcidin expression and properties of the Y-P30 peptide.
24562771 2014 Dermcidin expression is associated with disease progression and survival among breast cancer patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
More...