Property Summary

NCBI Gene PubMed Count 37
PubMed Score 772.67
PubTator Score 76.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 3.71336070986441E-16
Breast cancer 3099 5.67643069948264E-15
lung carcinoma 2844 4.13922781876748E-12
Duchenne muscular dystrophy 602 6.66088665024322E-7
pilocytic astrocytoma 3086 1.71267705603618E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.92754576681377E-5
posterior fossa group A ependymoma 1511 5.93796101202857E-5
juvenile dermatomyositis 1189 8.22087051932262E-5
pituitary cancer 1972 1.12897123980366E-4
cystic fibrosis 1670 1.74728316794886E-4
limb girdle muscular dystrophy 2I 56 4.87207917556347E-4
osteosarcoma 7933 5.62989444221224E-4
diabetes mellitus 1663 0.00106283354735609
fascioscapulohumeral muscular dystrophy 100 0.00133222158097288
ovarian cancer 8492 0.00200364769314466
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00200428100040134
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00379543446276067
Becker muscular dystrophy 187 0.00739138828245485
pediatric high grade glioma 2712 0.0116161340938898
interstitial cystitis 2299 0.0157772697146617
glioblastoma 5572 0.0280597136636244
esophageal adenocarcinoma 737 0.0325158241104495
spina bifida 1064 0.0450154860830425
Disease Target Count
Chudley-McCullough syndrome 1

Expression

Synonym

Accession P81274 Q5T1N8 Q6IBL7 Q8N0Z5
Symbols LGN
CMCS
PINS
DFNB82

Gene

PDB

4WND   4WNE   4WNF   4WNG   3SF4   5A6C  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (22)

PMID Text
26751642 This study determined the crystallographic structure of human Afadin in complex with LGN.
26662512 Kinocilium is essential for proper localization of Lgn, as well as Gai and aPKC, suggesting that cilium function plays a role in positioning of apical proteins critical for hearing.
26398908 results fit a model whereby LGN influences interphase microtubule dynamics in endothelial cells to regulate migration, cell adhesion, and sprout extension, and reveal a novel non-mitotic role for LGN in sprouting angiogenesis
25664792 A crystal structure of Frmpd4-bound LGN in an oxidized form is also reported, although oxidation does not appear to strongly affect the interaction with Frmpd4.
24165937 Hepatocyte Par1b defines lumen position in concert with the position of the astral microtubule anchoring complex LGN-NuMA to yield the distinct epithelial division phenotypes.
23907121 LGN is required for mitotic spindle rotation but not orientation maintenance.
23494849 one homozygous frameshift GPSM2 variants c.1473delG was identified in three Chudley-McCullough syndrome Dutch patients.
23389635 Data indicate that dynein- and astral microtubule-mediated transport of Galphai/LGN/nuclear mitotic apparatus (NuMA) complex from cell cortex to spindle poles.
22987632 Results show compound heterozygous mutations in the GPSM2 gene, in affected members of a family with Chudley-McCullough syndrome, co-segregate in the family as an autosomal recessive trait.
22977735 Studies indicate that the Inscuteable (Insc)and NuMA are mutually exclusive interactors of LGN.
More...

AA Sequence

MEENLISMREDHSFHVRYRMEASCLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDLKTLSAIYSQLGN      1 - 70
AYFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISRELNDKVG     71 - 140
EARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVRDALQAAVDFYEENLSLVTALGDRAAQGRAFGNLGN    141 - 210
THYLLGNFRDAVIAHEQRLLIAKEFGDKAAERRAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDRAV    211 - 280
EAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELNDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLE    281 - 350
ISREVGDKSGELTARLNLSDLQMVLGLSYSTNNSIMSENTEIDSSLNGVRPKLGRRHSMENMELMKLTPE    351 - 420
KVQNWNSEILAKQKPLIAKPSAKLLFVNRLKGKKYKTNSSTKVLQDASNSIDHRIPNSQRKISADTIGDE    421 - 490
GFFDLLSRFQSNRMDDQRCCLQEKNCHTASTTTSSTPPKMMLKTSSVPVVSPNTDEFLDLLASSQSRRLD    491 - 560
DQRASFSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFDILVKCQGSRLDDQRCAPPPATTKGPTVPDED    561 - 630
FFSLILRSQGKRMDEQRVLLQRDQNRDTDFGLKDFLQNNALLEFKNSGKKSADH                    631 - 684
//

Text Mined References (40)

PMID Year Title
27180139 2016 A novel nonsense GPSM2 mutation in a Yemeni family underlying Chudley-McCullough syndrome.
26751642 2016 Concomitant binding of Afadin to LGN and F-actin directs planar spindle orientation.
26662512 2016 The GPSM2/LGN GoLoco motifs are essential for hearing.
26398908 2015 LGN Directs Interphase Endothelial Cell Behavior via the Microtubule Network.
25664792 2015 Structural basis for the recognition of the scaffold protein Frmpd4/Preso1 by the TPR domain of the adaptor protein LGN.
24165937 2013 Par1b links lumen polarity with LGN-NuMA positioning for distinct epithelial cell division phenotypes.
23907121 2013 Automated tracking of mitotic spindle pole positions shows that LGN is required for spindle rotation but not orientation maintenance.
23783028 2013 RanGTP and CLASP1 cooperate to position the mitotic spindle.
23494849 2013 GPSM2 and Chudley-McCullough syndrome: a Dutch founder variant brought to North America.
23389635 2013 Evidence for dynein and astral microtubule-mediated cortical release and transport of G?i/LGN/NuMA complex in mitotic cells.
More...