Property Summary

NCBI Gene PubMed Count 336
Grant Count 439
R01 Count 223
Funding $68,778,321.69
PubMed Score 2012.87
PubTator Score 313.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma 2.700 0.003
atypical teratoid / rhabdoid tumor -1.700 0.001
medulloblastoma -1.800 0.000
medulloblastoma, large-cell -1.700 0.005
primitive neuroectodermal tumor -1.500 0.011
cystic fibrosis -2.100 0.000

Synonym

Accession P81172 Q1HE14 Q9BY68
Symbols HEPC
PLTR
HFE2B
LEAP1

Gene

PDB

1M4E   1M4F   2KEF   3H0T   4QAE  

Gene RIF (331)

PMID Text
27129231 TGF-beta1 may contribute to hepcidin synthesis during iron overload.
26981017 Studies indicate plasma and urine hepcidin as a marker of anemia of chronic disease and post-transplant anemia (PTA).
26866603 gonadotropin-stimulated endogenous estrogen markedly decreases circulating hepcidin-25 levels
26807955 Ceramide induced the binding of STAT3, but not NF-kappaB or c-Jun, to HAMP promoter.The mutation of STAT3 response element within 0.6 kb HAMP promoter region significantly inhibited the stimulatory effect of ceramide on HAMP promoter activity.
26582087 Identify 3 heterozygous missense mutations in BMP6 in patients with unexplained iron overload. These mutations lead to loss of signaling to SMAD proteins and reduced hepcidin production.
26515063 results clarify how commensal bacteria affect hepcidin expression and reveal a novel connection between IL-1beta and activation of BMP signaling.
26460251 erythropoietic drive, iron status, and inflammation all contribute to variation in hepcidin level.
26437604 The concentration of functional membrane-associated ferroportin is controlled by its ligand, the iron-regulatory hormone hepcidin, and fine-tuned by regulatory mechanisms serving iron homeostasis, oxygen utilization, host defense, and erythropoiesis.
26405701 Hepcidin levels are higher in NAFLD with iron overload.
26378394 Low hepcidin levels are associated with type 2 diabetes mellitus.
More...

AA Sequence

MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCC      1 - 70
GCCHRSKCGMCCKT                                                             71 - 84
//

Text Mined References (338)

PMID Year Title
27129231 2016 Transforming Growth Factor ?1 (TGF-?1) Activates Hepcidin mRNA Expression in Hepatocytes.
26981017 2016 Laboratory use of hepcidin in renal transplant recipients.
26866603 2016 Circulating Hepcidin-25 Is Reduced by Endogenous Estrogen in Humans.
26807955 2016 Ceramide Induces Human Hepcidin Gene Transcription through JAK/STAT3 Pathway.
26582087 2016 Heterozygous Mutations in BMP6 Pro-peptide Lead to Inappropriate Hepcidin Synthesis and Moderate Iron Overload in Humans.
26515063 2015 Commensal Bacteria-induced Interleukin 1? (IL-1?) Secreted by Macrophages Up-regulates Hepcidin Expression in Hepatocytes by Activating the Bone Morphogenetic Protein Signaling Pathway.
26460251 2015 Erythropoietic drive is the strongest predictor of hepcidin level in adults with sickle cell disease.
26437604 2015 Ironing out Ferroportin.
26405701 2015 The Relationship of Serum Hemojuvelin and Hepcidin Levels with Iron Overload in Nonalcoholic Fatty Liver Disease.
26378394 2016 Inadequate hepcidin serum concentrations predict incident type 2 diabetes mellitus.
More...