Property Summary

NCBI Gene PubMed Count 370
PubMed Score 2214.41
PubTator Score 313.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.700 9.7e-04
cystic fibrosis -2.100 3.2e-04
glioblastoma 2.700 2.5e-03
group 4 medulloblastoma -1.100 3.5e-02
medulloblastoma, large-cell -1.700 4.7e-03
primitive neuroectodermal tumor -1.500 1.1e-02

Gene RIF (365)

AA Sequence

MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCC      1 - 70
GCCHRSKCGMCCKT                                                             71 - 84
//

Text Mined References (372)

PMID Year Title