Property Summary

NCBI Gene PubMed Count 35
PubMed Score 84.67
PubTator Score 49.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Obesity 678 4.477 2.2
Breast Neoplasms 445 0.0 0.0
Hyperglycemia 137 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Prader-Willi syndrome 48 3.825 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
group 4 medulloblastoma 2.700 1.8e-03
Hydrolethalus syndrome 1.396 3.2e-02
malignant mesothelioma 3.100 2.0e-08
medulloblastoma, large-cell 2.700 1.9e-04

 OMIM Phenotype (1)

Gene RIF (25)

AA Sequence

MKEKSKNAARTRREKENSEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRVVFPEGLGEAWGHSSRT      1 - 70
SPLDNVGRELGSHLLQTLDGFIFVVAPDGKIMYISETASVHLGLSQVELTGNSIYEYIHPADHDEMTAVL     71 - 140
TAHQPYHSHFVQEYEIERSFFLRMKCVLAKRNAGLTCGGYKVIHCSGYLKIRQYSLDMSPFDGCYQNVGL    141 - 210
VAVGHSLPPSAVTEIKLHSNMFMFRASLDMKLIFLDSRVAELTGYEPQDLIEKTLYHHVHGCDTFHLRCA    211 - 280
HHLLLVKGQVTTKYYRFLAKHGGWVWVQSYATIVHNSRSSRPHCIVSVNYVLTDTEYKGLQLSLDQISAS    281 - 350
KPAFSYTSSSTPTMTDNRKGAKSRLSSSKSKSRTSPYPQYSGFHTERSESDHDSQWGGSPLTDTASPQLL    351 - 420
DPADRPGSQHDASCAYRQFSDRSSLCYGFALDHSRLVEERHFHTQACEGGRCEAGRYFLGTPQAGREPWW    421 - 490
GSRAALPLTKASPESREAYENSMPHIASVHRIHGRGHWDEDSVVSSPDPGSASESGDRYRTEQYQSSPHE    491 - 560
PSKIETLIRATQQMIKEEENRLQLRKAPSDQLASINGAGKKHSLCFANYQQPPPTGEVCHGSALANTSPC    561 - 630
DHIQQREGKMLSPHENDYDNSPTALSRISSPNSDRISKSSLILAKDYLHSDISPHQTAGDHPTVSPNCFG    631 - 700
SHRQYFDKHAYTLTGYALEHLYDSETIRNYSLGCNGSHFDVTSHLRMQPDPAQGHKGTSVIITNGS        701 - 766
//

Text Mined References (35)

PMID Year Title