Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MAWTVLLLGLLSHCTGSVTSYVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDS      1 - 70
DRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHPT                            71 - 117
//

Text Mined References (14)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11872955 2001 Nomenclature of the human immunoglobulin lambda (IGL) genes.
10591208 1999 The DNA sequence of human chromosome 22.
10510403 1999 Nephritogenic lambda light chain dimer: a unique human miniautoantibody against complement factor H.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
8028600 1994 Genomic organisation of 34 kb of the human immunoglobulin lambda locus (IGLV): restriction map and sequences of new V lambda III genes.
6780787 1980 Amino acid sequence of the lambda type light chain of a human IgGl myeloma protein (MOT) with unusual antigenicity: a possible new subgroup of lambda chain having a unique N-terminal sequence.
4452363 1974 A new subgroup of human L-chains of the lambda-type. Primary structure of Bence-Jones protein DEL.