Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P80748 A0A075B6J7 P01719 P01720
Symbols V2-14
IGLV321

Gene

PDB

2LOI  

AA Sequence

MAWTVLLLGLLSHCTGSVTSYVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDS      1 - 70
DRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHPT                            71 - 117
//

Text Mined References (14)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11872955 2001 Nomenclature of the human immunoglobulin lambda (IGL) genes.
10591208 1999 The DNA sequence of human chromosome 22.
10510403 1999 Nephritogenic lambda light chain dimer: a unique human miniautoantibody against complement factor H.
More...