Property Summary

NCBI Gene PubMed Count 107
PubMed Score 325.51
PubTator Score 323.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Atopic dermatitis 1.400 1.8e-02
chronic lymphosyte leukemia -1.900 5.2e-08
cutaneous lupus erythematosus 2.900 2.9e-03
cystic fibrosis 2.900 7.9e-05
esophageal adenocarcinoma -2.300 2.7e-02
interstitial cystitis 2.000 6.2e-03
intraductal papillary-mucinous adenoma (... -2.200 6.9e-03
intraductal papillary-mucinous carcinoma... -2.100 1.0e-02
intraductal papillary-mucinous neoplasm ... -2.300 4.1e-02
lung adenocarcinoma -1.400 3.1e-08
lung cancer -3.700 4.9e-06
lung carcinoma -2.200 2.0e-08
mucosa-associated lymphoid tissue lympho... 3.919 7.9e-03
non diabetic and post-ischemic heart fai... -1.100 9.7e-03
non-small cell lung cancer -2.655 1.0e-11
osteosarcoma -6.295 2.2e-04
ovarian cancer -1.200 2.8e-06
Pick disease 1.900 4.4e-02
psoriasis 5.300 7.5e-16
tuberculosis 1.700 1.6e-05
ulcerative colitis 3.100 1.2e-03
Waldenstrons macroglobulinemia 2.174 3.3e-02

Gene RIF (90)

AA Sequence

MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVD      1 - 70
FQEFISLVAIALKAAHYHTHKE                                                     71 - 92
//

Text Mined References (115)

PMID Year Title