Property Summary

NCBI Gene PubMed Count 92
PubMed Score 299.92
PubTator Score 323.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Mouth Diseases 12
Disease Target Count P-value
psoriasis 6685 0.0
non-small cell lung cancer 2798 1.03104115525823E-11
lung adenocarcinoma 2714 1.198223657805E-10
lung carcinoma 2844 2.01102716392298E-8
chronic lymphosyte leukemia 232 5.24816125214975E-8
lung cancer 4473 2.62506145417202E-7
ovarian cancer 8492 2.78043252752991E-6
tuberculosis 1563 1.64751862270301E-5
cystic fibrosis 1670 7.89467785061619E-5
osteosarcoma 7933 2.18878142833035E-4
ulcerative colitis 2087 0.00119796111037065
cutaneous lupus erythematosus 1056 0.00287790309555304
interstitial cystitis 2299 0.00621586294633431
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00688266447866653
mucosa-associated lymphoid tissue lymphoma 480 0.00792578173378429
non diabetic and post-ischemic heart failure 200 0.0096809893232342
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.010272179646185
Atopic dermatitis 944 0.0177303998364477
esophageal adenocarcinoma 737 0.0267144031264665
Waldenstrons macroglobulinemia 765 0.0334563320061304
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.041037960197762
Pick disease 1893 0.0440146620636628

Expression

Synonym

Accession P80511 P83219 Q5SY66 Q7M4R1
Symbols p6
CAGC
CGRP
MRP6
CAAF1
MRP-6
ENRAGE

Gene

PDB

1E8A   1GQM   1ODB   2M9G   2WC8   2WCB   2WCE   2WCF  

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid

Gene RIF (75)

PMID Text
26914918 an elevated serum level of S100A12 was an independent determinant of the progression of abdominal aortic calcification determined by lateral lumbar X-ray in Hemodialysis patients.
26339162 Our findings indicate that chitotriosidase and S10012A are useful in diagnosis and detection of subclinical inflammation and/or assessment of disease activity in FMF patients.
26274928 This is the first kinetics study of levels of RAGE main isoforms and ligands during ARDS. Elevated sRAGE, HMGB1 and S100A12, with decreased esRAGE and AGEs, were found to distinguish patients with ARDS from those without.
25964473 These assays showed that S100A12 is induced in response to Helicobacter pylori infection and inhibits bacterial growth and viability in vitro by binding nutrient zinc.
25854354 High mRNA expression of S100A12 is associated with bladder transitional cell carcinoma.
25825217 serum level elevated in acute liver failure
25650963 These findings suggested that S100A12 is an effective marker for inflammatory diseases.
25625487 High serum S100A12 expression is associated with poor response to therapy in Crohn's disease.
25438075 S100A12 is a biomarker of chronic heart failure that may also predict major cardiovascular events in patients with chronic heart failure.
25341801 highlight EN-RAGE as an inflammatory marker for future coronary heart disease (CHD) in a general population, beyond traditional CHD risk factors and inflammatory markers
More...

AA Sequence

MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVD      1 - 70
FQEFISLVAIALKAAHYHTHKE                                                     71 - 92
//

Text Mined References (100)

PMID Year Title
26914918 2016 Circulating S100A12 Levels Are Associated with Progression of Abdominal Aortic Calcification in Hemodialysis Patients.
26339162 2015 S1000A12, Chitotriosidase, and Resolvin D1 as Potential Biomarkers of Familial Mediterranean Fever.
26274928 2015 Soluble Forms and Ligands of the Receptor for Advanced Glycation End-Products in Patients with Acute Respiratory Distress Syndrome: An Observational Prospective Study.
25964473 2015 The Human Antimicrobial Protein Calgranulin C Participates in Control of Helicobacter pylori Growth and Regulation of Virulence.
25854354 2015 S100A12 and RAGE expression in human bladder transitional cell carcinoma: a role for the ligand/RAGE axis in tumor progression?
25825217 2015 Circulating levels of soluble receptor for advanced glycation end products and ligands of the receptor for advanced glycation end products in patients with acute liver failure.
25650963 2015 Elevated gene expression of S100A12 is correlated with the predominant clinical inflammatory factors in patients with bacterial pneumonia.
25625487 2015 Accuracies of serum and fecal S100 proteins (calprotectin and calgranulin C) to predict the response to TNF antagonists in patients with Crohn's disease.
25438075 2015 Usefulness of S100A12 as a prognostic biomarker for adverse events in patients with heart failure.
25341801 2014 EN-RAGE: a novel inflammatory marker for incident coronary heart disease.
More...