Property Summary

NCBI Gene PubMed Count 92
Grant Count 50
R01 Count 35
Funding $3,883,337.4
PubMed Score 299.92
PubTator Score 323.03

Knowledge Summary

Patent

No data available

Expression

Gene RIF (75)

PMID Text
26914918 an elevated serum level of S100A12 was an independent determinant of the progression of abdominal aortic calcification determined by lateral lumbar X-ray in Hemodialysis patients.
26339162 Our findings indicate that chitotriosidase and S10012A are useful in diagnosis and detection of subclinical inflammation and/or assessment of disease activity in FMF patients.
26274928 This is the first kinetics study of levels of RAGE main isoforms and ligands during ARDS. Elevated sRAGE, HMGB1 and S100A12, with decreased esRAGE and AGEs, were found to distinguish patients with ARDS from those without.
25964473 These assays showed that S100A12 is induced in response to Helicobacter pylori infection and inhibits bacterial growth and viability in vitro by binding nutrient zinc.
25854354 High mRNA expression of S100A12 is associated with bladder transitional cell carcinoma.
25825217 serum level elevated in acute liver failure
25650963 These findings suggested that S100A12 is an effective marker for inflammatory diseases.
25625487 High serum S100A12 expression is associated with poor response to therapy in Crohn's disease.
25438075 S100A12 is a biomarker of chronic heart failure that may also predict major cardiovascular events in patients with chronic heart failure.
25341801 highlight EN-RAGE as an inflammatory marker for future coronary heart disease (CHD) in a general population, beyond traditional CHD risk factors and inflammatory markers
More...

AA Sequence

MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVD      1 - 70
FQEFISLVAIALKAAHYHTHKE                                                     71 - 92
//

Text Mined References (100)

PMID Year Title
26914918 2016 Circulating S100A12 Levels Are Associated with Progression of Abdominal Aortic Calcification in Hemodialysis Patients.
26339162 2015 S1000A12, Chitotriosidase, and Resolvin D1 as Potential Biomarkers of Familial Mediterranean Fever.
26274928 2015 Soluble Forms and Ligands of the Receptor for Advanced Glycation End-Products in Patients with Acute Respiratory Distress Syndrome: An Observational Prospective Study.
25964473 2015 The Human Antimicrobial Protein Calgranulin C Participates in Control of Helicobacter pylori Growth and Regulation of Virulence.
25854354 2015 S100A12 and RAGE expression in human bladder transitional cell carcinoma: a role for the ligand/RAGE axis in tumor progression?
25825217 2015 Circulating levels of soluble receptor for advanced glycation end products and ligands of the receptor for advanced glycation end products in patients with acute liver failure.
25650963 2015 Elevated gene expression of S100A12 is correlated with the predominant clinical inflammatory factors in patients with bacterial pneumonia.
25625487 2015 Accuracies of serum and fecal S100 proteins (calprotectin and calgranulin C) to predict the response to TNF antagonists in patients with Crohn's disease.
25438075 2015 Usefulness of S100A12 as a prognostic biomarker for adverse events in patients with heart failure.
25341801 2014 EN-RAGE: a novel inflammatory marker for incident coronary heart disease.
More...