Property Summary

NCBI Gene PubMed Count 34
PubMed Score 94.69
PubTator Score 366.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung carcinoma 2844 1.55459235688289E-55
group 4 medulloblastoma 1875 6.44905366226053E-11
medulloblastoma, large-cell 6234 2.78122421662247E-7
ulcerative colitis 2087 1.20248700565678E-5
Pick disease 1893 4.85899294025189E-5
lung cancer 4473 6.75092119039942E-5
malignant mesothelioma 3163 7.05918915329002E-5
breast carcinoma 1614 8.30924912301386E-5
Breast cancer 3099 1.73494686950053E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.23749345026594E-4
fibroadenoma 557 2.29417432564881E-4
pancreatic cancer 2300 2.64482287028371E-4
oligodendroglioma 2849 3.0915351849148E-4
interstitial cystitis 2299 4.112586684041E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 5.02250045956635E-4
cystic fibrosis 1670 0.00102868270743419
osteosarcoma 7933 0.00105486540979689
atypical teratoid / rhabdoid tumor 4369 0.00137138767713023
psoriasis 6685 0.00172887148753116
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00223434854559832
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00372727818801544
nasopharyngeal carcinoma 1056 0.00413454137153599
astrocytic glioma 2241 0.00904578406279246
pediatric high grade glioma 2712 0.00909847496307928
chronic rhinosinusitis 512 0.00962895916333543
subependymal giant cell astrocytoma 2287 0.0106011343768646
nephrosclerosis 329 0.0226729773063485
ovarian cancer 8492 0.0247253640510541
colon cancer 1475 0.0266862896864597
glioblastoma 5572 0.0269662996293753
non primary Sjogren syndrome sicca 840 0.0338852386449219
primitive neuroectodermal tumor 3031 0.0401271034241257
Disease Target Count
Gaba-Transaminase Deficiency 1
Disease Target Count
GABA transaminase deficiency 1

Expression

Synonym

Accession P80404 A8K386 Q16260 Q8N5W2 Q96BG2 Q99800
Symbols GABAT
NPD009
GABA-AT

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (16)

PMID Text
25771305 This study utilized ER+ IBC to identify a metagene including ABAT and STC2 as predictive biomarkers for endocrine therapy resistance.
25485164 A-to-G transition at nucleotide 754 of the human ABAT gene identified in lymphoblast cDNA (c.754A>G) results in substitution of an invariant arginine at amino acid 220 by lysine (p.Arg220Lys). This point mutation results in destabilization of the binding of pyridoxal-5'-phosphate to GABA-transaminase (required for transamination of GABA to succinic semialdehyde) and thus results in GABA-transaminase deficiency.
22225676 Findings point to a possible role of ABAT gene-regulated GABA catabolism for an altered processing of somatosensory stimuli as a potential vulnerability marker for affective disorders.
21552517 direct involvement of ABAT in pathways affecting lower esophageal sphincter (LES) control in gastro esophageal reflux disease
20877624 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20659789 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20052547 excessive prenatal GABA exposure in the central nervous system (CNS) is responsible for the clinical manifestations of GABA transaminase deficiency [case report]
19598235 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MASMLLAQRLACSFQHSYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSQELMKQLNIIQNAEA      1 - 70
VHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQNASMFVNRPALGILPPENFV     71 - 140
EKLRQSLLSVAPKGMSQLITMACGSCSNENALKTIFMWYRSKERGQRGFSQEELETCMINQAPGCPDYSI    141 - 210
LSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKY    211 - 280
RKKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPA    281 - 350
DVMTFSKKMMTGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLL    351 - 420
DLQARYPQFISRVRGRGTFCSFDTPDDSIRNKLILIARNKGVVLGGCGDKSIRFRPTLVFRDHHAHLFLN    421 - 490
IFSDILADFK                                                                491 - 500
//

Text Mined References (36)

PMID Year Title
25771305 2015 Decreased expression of ABAT and STC2 hallmarks ER-positive inflammatory breast cancer and endocrine therapy resistance in advanced disease.
25485164 2014 Disorders of GABA metabolism: SSADH and GABA-transaminase deficiencies.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24489884 2014 Genome-wide association study of proneness to anger.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22225676 2013 Variants within the GABA transaminase (ABAT) gene region are associated with somatosensory evoked EEG potentials in families at high risk for affective disorders.
21552517 2011 4-aminobutyrate aminotransferase (ABAT): genetic and pharmacological evidence for an involvement in gastro esophageal reflux disease.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...