Property Summary

Ligand Count 4
NCBI Gene PubMed Count 34
PubMed Score 104.33
PubTator Score 366.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Succinic semialdehyde dehydrogenase deficiency 16 5.49 2.7
Disease Target Count
Gaba-Transaminase Deficiency 1

Expression

  Differential Expression (32)

Disease log2 FC p
adult high grade glioma -1.300 1.5e-04
astrocytic glioma 1.500 9.0e-03
atypical teratoid / rhabdoid tumor -2.000 2.5e-03
Breast cancer -1.100 1.7e-04
breast carcinoma 1.500 8.3e-05
chronic rhinosinusitis -1.445 9.6e-03
colon cancer -2.200 2.7e-02
cystic fibrosis -1.380 1.0e-03
fibroadenoma 1.100 2.3e-04
glioblastoma -1.700 3.2e-02
group 3 medulloblastoma -1.900 4.5e-04
interstitial cystitis -1.500 1.9e-02
intraductal papillary-mucinous adenoma (... -1.700 2.2e-04
intraductal papillary-mucinous carcinoma... -2.700 3.7e-03
intraductal papillary-mucinous neoplasm ... -2.700 5.0e-04
lung cancer -1.700 6.8e-05
lung carcinoma 3.700 1.6e-55
malignant mesothelioma -1.100 7.1e-05
medulloblastoma, large-cell -5.800 2.8e-07
nasopharyngeal carcinoma -1.300 4.1e-03
nephrosclerosis -1.163 2.2e-02
non primary Sjogren syndrome sicca 1.100 3.4e-02
oligodendroglioma 2.200 3.1e-04
osteosarcoma -2.955 1.1e-03
ovarian cancer 1.200 2.6e-08
pancreatic cancer -1.800 5.5e-04
pancreatic ductal adenocarcinoma liver m... -1.322 5.6e-03
Pick disease -1.200 4.9e-05
primitive neuroectodermal tumor -1.100 4.0e-02
psoriasis -1.300 1.3e-09
subependymal giant cell astrocytoma -1.329 1.1e-02
ulcerative colitis -2.100 1.2e-05

 GWAS Trait (1)

Gene RIF (16)

AA Sequence

MASMLLAQRLACSFQHSYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSQELMKQLNIIQNAEA      1 - 70
VHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQNASMFVNRPALGILPPENFV     71 - 140
EKLRQSLLSVAPKGMSQLITMACGSCSNENALKTIFMWYRSKERGQRGFSQEELETCMINQAPGCPDYSI    141 - 210
LSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKY    211 - 280
RKKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPA    281 - 350
DVMTFSKKMMTGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLL    351 - 420
DLQARYPQFISRVRGRGTFCSFDTPDDSIRNKLILIARNKGVVLGGCGDKSIRFRPTLVFRDHHAHLFLN    421 - 490
IFSDILADFK                                                                491 - 500
//

Text Mined References (36)

PMID Year Title