Property Summary

Ligand Count 9
NCBI Gene PubMed Count 133
PubMed Score 430.47
PubTator Score 448.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Fetal Growth Retardation 189 0.0 0.0
Myelodysplastic Syndromes 26 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Eye and adnexa disease 18 0.0 1.4
Disease Target Count Z-score Confidence
Cancer 2499 3.758 1.9
Obesity 678 3.724 1.9
Silver-Russell syndrome 39 3.041 1.5

Expression

Gene RIF (89)

AA Sequence

MTATEALLRVLLLLLAFGHSTYGAECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGE      1 - 70
PGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQH     71 - 140
GGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVT    141 - 210
NCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQP    211 - 280
EHRILKVSMKELNKKTPLLTEGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRKKKNLL    281 - 350
LQYNSGEDLAVNIIFPEKIDMTTFSKEAGDEEI                                         351 - 383
//

Text Mined References (135)

PMID Year Title