Property Summary

NCBI Gene PubMed Count 151
Grant Count 162
R01 Count 62
Funding $37,165,089.81
PubMed Score 1104.10
PubTator Score 556.14

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P80365 A7LB28 C5HTY7 Q13194 Q6P2G9 Q8N439 Q96QN8 Q9UC50 Q9UC51 Q9UCW5 Q9UCW6 Q9UCW7 Q9UCW8
Symbols AME
AME1
HSD2
HSD11K
SDR9C3

Gene

PANTHER Protein Class (2)

Gene RIF (129)

PMID Text
26798634 zearalenone is a selective inhibitor of HSD11B2, implying that this agent may cause excessive glucocorticoid action in local tissues such as kidney and placentas.
26593902 maternal depression and anxiety may impact on fetal programming by down-regulating HSD11B2, and antidepressant treatment alone is unlikely to protect against this effect.
26585459 Infants with the high-risk neurobehavioral profile showed more methylation than infants with the low-risk neurobehavioral profile at CpG3 for NR3C1 and less methylation of CpG3 for HSD11B2.
26462907 growth potential of fetus related to the 11beta-HSD2 expression in the placenta, and 11beta-HSD2 expression related to the trace metals status of the mother
26343289 Data show that glucocorticoid response genes NR3C1, ADCYAP1R1 and HSD11B2 were relatively hypomethylated whereas FKBP5 was hypermethylated.
26126204 A novel HSD11B2 functional mutation accounting for an Ala221Gly substitution causes Apparent mineralocorticoid excess. The hypertension phenotype is also epigenetically modulated by HSD11B2 methylation in subjects heterozygous for the mutation
26115144 No interaction was found between HSD11B2 and exposure during pregnancy, but individuals with the A allele of rs5479 had an increased risk of schizophrenia after exposure at age 3-9 years
26011146 11betaHSD2 inhibition suppressed lung tumor growth and invasion in association with increased tissue active glucocorticoid levels, decreased COX-2 expression, inhibition of ERK and mTOR signaling pathways.
25907225 The CA-repeat length did not influence BP levels or serum F/E ratios in pediatric subjects. However, the serum F/E ratio was associated with BP, suggesting a role of 11betaHSD2 in mineralocorticoid hypertension.
25788665 Our work is one of the first comprehensive views of DNA methylation and expression in the placenta for both HSD11B types 1 and 2, linking epigenetic alterations with the regulation of fetal stress and birth weight outcomes.
More...

AA Sequence

MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALS      1 - 70
RLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLT     71 - 140
KPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSS    141 - 210
RGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRK    211 - 280
QLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFI    281 - 350
HYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR                   351 - 405
//

Text Mined References (152)

PMID Year Title
26798634 2015 Zearalenone Inhibits Rat and Human 11?-Hydroxysteroid Dehydrogenase Type 2.
26593902 2015 Maternal Prenatal Mental Health and Placental 11?-HSD2 Gene Expression: Initial Findings from the Mercy Pregnancy and Emotional Wellbeing Study.
26585459 2015 Neurobehavior related to epigenetic differences in preterm infants.
26462907 2015 Placental 11?-Hydroxysteroid dehydrogenase type 2 expression: Correlations with birth weight and placental metal concentrations.
26343289 2015 Placental epigenetic patterning of glucocorticoid response genes is associated with infant neurodevelopment.
26126204 2015 Apparent Mineralocorticoid Excess by a Novel Mutation and Epigenetic Modulation by HSD11B2 Promoter Methylation.
26115144 2015 Investigating interactions between early life stress and two single nucleotide polymorphisms in HSD11B2 on the risk of schizophrenia.
26011146 2015 Inhibition of 11?-Hydroxysteroid Dehydrogenase Type II Suppresses Lung Carcinogenesis by Blocking Tumor COX-2 Expression as Well as the ERK and mTOR Signaling Pathways.
25907225 2016 Citosine-Adenine-Repeat Microsatellite of 11?-hydroxysteroid dehydrogenase 2 Gene in Hypertensive Children.
25788665 2015 The Role of Placental 11-Beta Hydroxysteroid Dehydrogenase Type 1 and Type 2 Methylation on Gene Expression and Infant Birth Weight.
More...