Property Summary

Ligand Count 50
NCBI Gene PubMed Count 164
PubMed Score 1171.55
PubTator Score 556.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Gastritis 47
Disease Target Count
Type 1 diabetes mellitus 109

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease -1.465 1.2e-02
active ulcerative colitis -1.445 2.9e-02
colon cancer -2.300 2.8e-06
cutaneous lupus erythematosus -2.000 3.0e-02
cystic fibrosis -2.200 8.9e-05
intraductal papillary-mucinous adenoma (... 1.200 1.5e-02
intraductal papillary-mucinous carcinoma... 1.300 6.6e-03
intraductal papillary-mucinous neoplasm ... 1.600 7.6e-04
invasive ductal carcinoma -1.135 1.6e-02
medulloblastoma 2.000 4.6e-04
medulloblastoma, large-cell 2.000 7.6e-04
nephrosclerosis -1.611 4.6e-02
osteosarcoma -1.356 6.0e-03
primary Sjogren syndrome -1.500 3.7e-02
psoriasis -1.900 1.7e-09

Gene RIF (142)

AA Sequence

MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALS      1 - 70
RLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLT     71 - 140
KPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSS    141 - 210
RGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRK    211 - 280
QLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFI    281 - 350
HYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR                   351 - 405
//

Text Mined References (165)

PMID Year Title