Property Summary

NCBI Gene PubMed Count 98
PubMed Score 120.29
PubTator Score 171.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease 2.219 1.5e-03
Amyotrophic lateral sclerosis 1.408 1.2e-06
colon cancer -1.100 1.7e-02
diabetes mellitus -1.100 2.9e-02
ependymoma 1.100 2.7e-08
gastric carcinoma -1.500 3.4e-02
glioblastoma 1.100 2.5e-03
group 3 medulloblastoma 1.300 3.0e-04
intraductal papillary-mucinous adenoma (... -1.500 6.8e-03
intraductal papillary-mucinous carcinoma... -1.900 8.3e-03
intraductal papillary-mucinous neoplasm ... -3.000 1.2e-03
lung cancer -1.800 8.7e-04
malignant mesothelioma -1.400 3.8e-07
nasopharyngeal carcinoma -1.400 7.0e-05
nephrosclerosis 1.095 2.6e-04
osteosarcoma -1.886 6.2e-03
ovarian cancer -1.200 1.3e-02
pancreatic cancer -1.400 7.0e-04
pancreatic ductal adenocarcinoma liver m... -2.080 2.6e-04
Pneumonia -1.400 9.7e-03
progressive supranuclear palsy -1.300 9.9e-03
psoriasis -1.200 2.7e-03
subependymal giant cell astrocytoma 2.254 4.5e-02
ulcerative colitis 1.900 8.2e-08
Waldenstrons macroglobulinemia 1.405 2.6e-02

Gene RIF (83)

AA Sequence

MRWRTILLQYCFLLITCLLTALEAVPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKH      1 - 70
FREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDELKRQEVGRLRMLIKAKLDSLQDIGMDHQALLKQFD     71 - 140
HLNHLNPDKFESTDLDMLIKAATSDLEHYDKTRHEEFKKYEMMKEHERREYLKTLNEEKRKEEESKFEEM    141 - 210
KKKHENHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNSDGFLDEQELEALFTKELEKVYDP    211 - 280
KNEEDDMVEMEEERLRMREHVMSEVDTNKDRLVTLEEFLKATEKKEFLEPDSWETLDQQQFFTEEELKEY    281 - 350
ENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIPPSGPAGELKFEPHI    351 - 420
//

Text Mined References (104)

PMID Year Title