Property Summary

NCBI Gene PubMed Count 85
PubMed Score 111.04
PubTator Score 171.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.02488978365992E-8
ulcerative colitis 2087 8.17093632523602E-8
malignant mesothelioma 3163 3.76838095439819E-7
Amyotrophic Lateral Sclerosis 432 1.18354459616146E-6
ovarian cancer 8492 2.67917575198112E-6
nasopharyngeal carcinoma 1056 6.95731158698789E-5
nephrosclerosis 329 2.55970833334168E-4
group 3 medulloblastoma 2254 3.04987574749249E-4
lung cancer 4473 8.67957006785617E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00124250812134288
active Crohn's disease 918 0.00153017127386203
glioblastoma 5572 0.00251466883729796
psoriasis 6685 0.0026653818529146
osteosarcoma 7933 0.00618704370560866
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00676563175888227
primary pancreatic ductal adenocarcinoma 1271 0.00709835338514645
pancreatic cancer 2300 0.00724748188538136
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00829169722646817
Pneumonia 133 0.0097098556964139
progressive supranuclear palsy 674 0.00988599069312462
colon cancer 1475 0.0166879222634538
Waldenstrons macroglobulinemia 765 0.0263243311409495
diabetes mellitus 1663 0.028730545821931
gastric carcinoma 832 0.0336631603446689
subependymal giant cell astrocytoma 2287 0.0447583595791377
Disease Target Count Z-score Confidence
Obesity 616 3.657 1.8

Expression

Synonym

Accession P80303 A8K642 D3DQX5 Q8NFT5
Symbols NEFA
HEL-S-109

Gene

  Ortholog (14)

 GWAS Trait (1)

Pathway (1)

Gene RIF (70)

PMID Text
26831553 Data indicate a positive correlation of nesfatin-1 and a negative correlation of orexin-A with body mass index.
26744860 nesfatin-1 might have an important role in regulation of food intake and pathogenesis of loss of appetite in children.
26624852 1012C>G polymorphism of NUCB2 is correlated with a reduced risk of developing MetS in a Chinese Han population.
26162003 Circulating NUCB2/nesfatin-1 levels correlated positively with perceived anxiety, whereas no association with body mass index or eating disorder symptoms was observed.
26143537 These results corroborate the suggestion of NUCB2/nesfatin-1 being relevantly involved in the regulation of mood and stress in a sex-specific way
25872767 This investigation indicates a marked association of serum and synovial fluid nesfatin-1 concentrations with osteoarthritis disease severity.
25869615 nesfatin-1 inhibits the growth of adrenocortical H295R cells and promotes apoptosis, potentially via the involvement of Bax, BCL-XL and BCL-2 genes as well as ERK1/2, p38 and JNK1/2 signalling cascades
25841171 This study shows an association of serum nesfatin-1 concentrations and the development and severity of peripheral arterial disease in type 2 diabetes mellitus patients.
25833360 Serum nesfatin-1 levels are significantly higher in girls with premature thelarche compared to prepubertal controls.
25581765 Plasma IL-6 and TNF-alpha did not significantly change after training, but nesfatin increased significantly only with high-intensity interval training compared with the control group.
More...

AA Sequence

MRWRTILLQYCFLLITCLLTALEAVPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKH      1 - 70
FREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDELKRQEVGRLRMLIKAKLDSLQDIGMDHQALLKQFD     71 - 140
HLNHLNPDKFESTDLDMLIKAATSDLEHYDKTRHEEFKKYEMMKEHERREYLKTLNEEKRKEEESKFEEM    141 - 210
KKKHENHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNSDGFLDEQELEALFTKELEKVYDP    211 - 280
KNEEDDMVEMEEERLRMREHVMSEVDTNKDRLVTLEEFLKATEKKEFLEPDSWETLDQQQFFTEEELKEY    281 - 350
ENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIPPSGPAGELKFEPHI    351 - 420
//

Text Mined References (91)

PMID Year Title
26831553 2015 Correlation of Brain Neuropeptide (Nesfatin-1 and Orexin-A) Concentrations with Anthropometric and Biochemical Parameters in Malnourished Children.
26744860 2015 Role of circulating nesfatin-1 in the underweight children with poor appetite.
26624852 2016 Association of the Polymorphism in Nucleobindin 2 Gene and the Risk of Metabolic Syndrome.
26162003 2015 NUCB2/nesfatin-1 Is Associated with Elevated Levels of Anxiety in Anorexia Nervosa.
26143537 2015 Sex-specific regulation of NUCB2/nesfatin-1: Differential implication in anxiety in obese men and women.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25872767 2015 Serum and synovial fluid nesfatin-1 concentration is associated with radiographic severity of knee osteoarthritis.
25869615 2015 Nesfatin-1 inhibits proliferation and enhances apoptosis of human adrenocortical H295R cells.
25841171 2015 Serum nesfatin-1 is reduced in type 2 diabetes mellitus patients with peripheral arterial disease.
25833360 2015 Serum nesfatin-1 and leptin levels in non-obese girls with premature thelarche.
More...