Tbio | Nucleobindin-2 |
Nesfatin-1: Anorexigenic peptide, seems to play an important role in hypothalamic pathways regulating food intake and energy homeostasis, acting in a leptin-independent manner. May also exert hypertensive roles and modulate blood pressure through directly acting on peripheral arterial resistance (By similarity).
This gene encodes a protein with a suggested role in calcium level maintenance, eating regulation in the hypothalamus, and release of tumor necrosis factor from vascular endothelial cells. This protein binds calcium and has EF-folding domains. [provided by RefSeq, Oct 2011]
This gene encodes a protein with a suggested role in calcium level maintenance, eating regulation in the hypothalamus, and release of tumor necrosis factor from vascular endothelial cells. This protein binds calcium and has EF-folding domains. [provided by RefSeq, Oct 2011]
Comments
Disease | Target Count |
---|---|
Prostatic Neoplasms | 471 |
Disease | log2 FC | p |
---|---|---|
nephrosclerosis | 1.095 | 0.000 |
Waldenstrons macroglobulinemia | 1.405 | 0.026 |
malignant mesothelioma | -1.400 | 0.000 |
psoriasis | -1.200 | 0.003 |
osteosarcoma | -1.886 | 0.006 |
posterior fossa group B ependymoma | 1.400 | 0.000 |
glioblastoma | 1.100 | 0.003 |
Amyotrophic Lateral Sclerosis | 1.408 | 0.000 |
primary pancreatic ductal adenocarcinoma | -2.238 | 0.007 |
intraductal papillary-mucinous adenoma (... | -1.500 | 0.007 |
intraductal papillary-mucinous carcinoma... | -1.900 | 0.008 |
intraductal papillary-mucinous neoplasm ... | -3.000 | 0.001 |
lung cancer | -1.800 | 0.001 |
colon cancer | -1.100 | 0.017 |
active Crohn's disease | 2.219 | 0.002 |
pancreatic cancer | -2.300 | 0.007 |
diabetes mellitus | -1.100 | 0.029 |
group 3 medulloblastoma | 1.300 | 0.000 |
Pneumonia | -1.400 | 0.010 |
subependymal giant cell astrocytoma | 2.254 | 0.045 |
nasopharyngeal carcinoma | -1.400 | 0.000 |
progressive supranuclear palsy | -1.300 | 0.010 |
gastric carcinoma | -1.500 | 0.034 |
ulcerative colitis | 1.900 | 0.000 |
ovarian cancer | 3.200 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA Inparanoid |
Xenopus | OMA EggNOG |
C. elegans | OMA EggNOG |
PMID | Text |
---|---|
26831553 | Data indicate a positive correlation of nesfatin-1 and a negative correlation of orexin-A with body mass index. |
26744860 | nesfatin-1 might have an important role in regulation of food intake and pathogenesis of loss of appetite in children. |
26624852 | 1012C>G polymorphism of NUCB2 is correlated with a reduced risk of developing MetS in a Chinese Han population. |
26162003 | Circulating NUCB2/nesfatin-1 levels correlated positively with perceived anxiety, whereas no association with body mass index or eating disorder symptoms was observed. |
26143537 | These results corroborate the suggestion of NUCB2/nesfatin-1 being relevantly involved in the regulation of mood and stress in a sex-specific way |
25872767 | This investigation indicates a marked association of serum and synovial fluid nesfatin-1 concentrations with osteoarthritis disease severity. |
25869615 | nesfatin-1 inhibits the growth of adrenocortical H295R cells and promotes apoptosis, potentially via the involvement of Bax, BCL-XL and BCL-2 genes as well as ERK1/2, p38 and JNK1/2 signalling cascades |
25841171 | This study shows an association of serum nesfatin-1 concentrations and the development and severity of peripheral arterial disease in type 2 diabetes mellitus patients. |
25833360 | Serum nesfatin-1 levels are significantly higher in girls with premature thelarche compared to prepubertal controls. |
25581765 | Plasma IL-6 and TNF-alpha did not significantly change after training, but nesfatin increased significantly only with high-intensity interval training compared with the control group. |
More... |
MRWRTILLQYCFLLITCLLTALEAVPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKH 1 - 70 FREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDELKRQEVGRLRMLIKAKLDSLQDIGMDHQALLKQFD 71 - 140 HLNHLNPDKFESTDLDMLIKAATSDLEHYDKTRHEEFKKYEMMKEHERREYLKTLNEEKRKEEESKFEEM 141 - 210 KKKHENHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNSDGFLDEQELEALFTKELEKVYDP 211 - 280 KNEEDDMVEMEEERLRMREHVMSEVDTNKDRLVTLEEFLKATEKKEFLEPDSWETLDQQQFFTEEELKEY 281 - 350 ENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIPPSGPAGELKFEPHI 351 - 420 //
PMID | Year | Title |
---|---|---|
26831553 | 2015 | Correlation of Brain Neuropeptide (Nesfatin-1 and Orexin-A) Concentrations with Anthropometric and Biochemical Parameters in Malnourished Children. |
26744860 | 2015 | Role of circulating nesfatin-1 in the underweight children with poor appetite. |
26624852 | 2016 | Association of the Polymorphism in Nucleobindin 2 Gene and the Risk of Metabolic Syndrome. |
26162003 | 2015 | NUCB2/nesfatin-1 Is Associated with Elevated Levels of Anxiety in Anorexia Nervosa. |
26143537 | 2015 | Sex-specific regulation of NUCB2/nesfatin-1: Differential implication in anxiety in obese men and women. |
25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
25872767 | 2015 | Serum and synovial fluid nesfatin-1 concentration is associated with radiographic severity of knee osteoarthritis. |
25869615 | 2015 | Nesfatin-1 inhibits proliferation and enhances apoptosis of human adrenocortical H295R cells. |
25841171 | 2015 | Serum nesfatin-1 is reduced in type 2 diabetes mellitus patients with peripheral arterial disease. |
25833360 | 2015 | Serum nesfatin-1 and leptin levels in non-obese girls with premature thelarche. |
More... |