Property Summary

NCBI Gene PubMed Count 85
Grant Count 6
Funding $551,029.66
PubMed Score 111.04
PubTator Score 171.85

Knowledge Summary

Patent

No data available

Expression

Gene RIF (70)

PMID Text
26831553 Data indicate a positive correlation of nesfatin-1 and a negative correlation of orexin-A with body mass index.
26744860 nesfatin-1 might have an important role in regulation of food intake and pathogenesis of loss of appetite in children.
26624852 1012C>G polymorphism of NUCB2 is correlated with a reduced risk of developing MetS in a Chinese Han population.
26162003 Circulating NUCB2/nesfatin-1 levels correlated positively with perceived anxiety, whereas no association with body mass index or eating disorder symptoms was observed.
26143537 These results corroborate the suggestion of NUCB2/nesfatin-1 being relevantly involved in the regulation of mood and stress in a sex-specific way
25872767 This investigation indicates a marked association of serum and synovial fluid nesfatin-1 concentrations with osteoarthritis disease severity.
25869615 nesfatin-1 inhibits the growth of adrenocortical H295R cells and promotes apoptosis, potentially via the involvement of Bax, BCL-XL and BCL-2 genes as well as ERK1/2, p38 and JNK1/2 signalling cascades
25841171 This study shows an association of serum nesfatin-1 concentrations and the development and severity of peripheral arterial disease in type 2 diabetes mellitus patients.
25833360 Serum nesfatin-1 levels are significantly higher in girls with premature thelarche compared to prepubertal controls.
25581765 Plasma IL-6 and TNF-alpha did not significantly change after training, but nesfatin increased significantly only with high-intensity interval training compared with the control group.
More...

AA Sequence

MRWRTILLQYCFLLITCLLTALEAVPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKH      1 - 70
FREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDELKRQEVGRLRMLIKAKLDSLQDIGMDHQALLKQFD     71 - 140
HLNHLNPDKFESTDLDMLIKAATSDLEHYDKTRHEEFKKYEMMKEHERREYLKTLNEEKRKEEESKFEEM    141 - 210
KKKHENHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNSDGFLDEQELEALFTKELEKVYDP    211 - 280
KNEEDDMVEMEEERLRMREHVMSEVDTNKDRLVTLEEFLKATEKKEFLEPDSWETLDQQQFFTEEELKEY    281 - 350
ENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIPPSGPAGELKFEPHI    351 - 420
//

Text Mined References (91)

PMID Year Title
26831553 2015 Correlation of Brain Neuropeptide (Nesfatin-1 and Orexin-A) Concentrations with Anthropometric and Biochemical Parameters in Malnourished Children.
26744860 2015 Role of circulating nesfatin-1 in the underweight children with poor appetite.
26624852 2016 Association of the Polymorphism in Nucleobindin 2 Gene and the Risk of Metabolic Syndrome.
26162003 2015 NUCB2/nesfatin-1 Is Associated with Elevated Levels of Anxiety in Anorexia Nervosa.
26143537 2015 Sex-specific regulation of NUCB2/nesfatin-1: Differential implication in anxiety in obese men and women.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25872767 2015 Serum and synovial fluid nesfatin-1 concentration is associated with radiographic severity of knee osteoarthritis.
25869615 2015 Nesfatin-1 inhibits proliferation and enhances apoptosis of human adrenocortical H295R cells.
25841171 2015 Serum nesfatin-1 is reduced in type 2 diabetes mellitus patients with peripheral arterial disease.
25833360 2015 Serum nesfatin-1 and leptin levels in non-obese girls with premature thelarche.
More...