| Tbio | Nucleobindin-2 |
Nesfatin-1: Anorexigenic peptide, seems to play an important role in hypothalamic pathways regulating food intake and energy homeostasis, acting in a leptin-independent manner. May also exert hypertensive roles and modulate blood pressure through directly acting on peripheral arterial resistance (By similarity).
This gene encodes a protein with a suggested role in calcium level maintenance, eating regulation in the hypothalamus, and release of tumor necrosis factor from vascular endothelial cells. This protein binds calcium and has EF-folding domains. [provided by RefSeq, Oct 2011]
This gene encodes a protein with a suggested role in calcium level maintenance, eating regulation in the hypothalamus, and release of tumor necrosis factor from vascular endothelial cells. This protein binds calcium and has EF-folding domains. [provided by RefSeq, Oct 2011]
Comments
Property Summary
| NCBI Gene PubMed Count | 85 |
| Grant Count | 6 |
| Funding | $551,029.66 |
| PubMed Score | 111.04 |
| PubTator Score | 171.85 |
| Disease | log2 FC | p |
|---|---|---|
| nephrosclerosis | 1.095 | 0.000 |
| Waldenstrons macroglobulinemia | 1.405 | 0.026 |
| malignant mesothelioma | -1.400 | 0.000 |
| psoriasis | -1.200 | 0.003 |
| osteosarcoma | -1.886 | 0.006 |
| posterior fossa group B ependymoma | 1.400 | 0.000 |
| glioblastoma | 1.100 | 0.003 |
| Amyotrophic Lateral Sclerosis | 1.408 | 0.000 |
| primary pancreatic ductal adenocarcinoma | -2.238 | 0.007 |
| intraductal papillary-mucinous adenoma (... | -1.500 | 0.007 |
| intraductal papillary-mucinous carcinoma... | -1.900 | 0.008 |
| intraductal papillary-mucinous neoplasm ... | -3.000 | 0.001 |
| lung cancer | -1.800 | 0.001 |
| colon cancer | -1.100 | 0.017 |
| active Crohn's disease | 2.219 | 0.002 |
| pancreatic cancer | -2.300 | 0.007 |
| diabetes mellitus | -1.100 | 0.029 |
| group 3 medulloblastoma | 1.300 | 0.000 |
| Pneumonia | -1.400 | 0.010 |
| subependymal giant cell astrocytoma | 2.254 | 0.045 |
| nasopharyngeal carcinoma | -1.400 | 0.000 |
| progressive supranuclear palsy | -1.300 | 0.010 |
| gastric carcinoma | -1.500 | 0.034 |
| ulcerative colitis | 1.900 | 0.000 |
| ovarian cancer | 3.200 | 0.000 |
| PMID | Text |
|---|---|
| 26831553 | Data indicate a positive correlation of nesfatin-1 and a negative correlation of orexin-A with body mass index. |
| 26744860 | nesfatin-1 might have an important role in regulation of food intake and pathogenesis of loss of appetite in children. |
| 26624852 | 1012C>G polymorphism of NUCB2 is correlated with a reduced risk of developing MetS in a Chinese Han population. |
| 26162003 | Circulating NUCB2/nesfatin-1 levels correlated positively with perceived anxiety, whereas no association with body mass index or eating disorder symptoms was observed. |
| 26143537 | These results corroborate the suggestion of NUCB2/nesfatin-1 being relevantly involved in the regulation of mood and stress in a sex-specific way |
| 25872767 | This investigation indicates a marked association of serum and synovial fluid nesfatin-1 concentrations with osteoarthritis disease severity. |
| 25869615 | nesfatin-1 inhibits the growth of adrenocortical H295R cells and promotes apoptosis, potentially via the involvement of Bax, BCL-XL and BCL-2 genes as well as ERK1/2, p38 and JNK1/2 signalling cascades |
| 25841171 | This study shows an association of serum nesfatin-1 concentrations and the development and severity of peripheral arterial disease in type 2 diabetes mellitus patients. |
| 25833360 | Serum nesfatin-1 levels are significantly higher in girls with premature thelarche compared to prepubertal controls. |
| 25581765 | Plasma IL-6 and TNF-alpha did not significantly change after training, but nesfatin increased significantly only with high-intensity interval training compared with the control group. |
| More... |
MRWRTILLQYCFLLITCLLTALEAVPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKH 1 - 70 FREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDELKRQEVGRLRMLIKAKLDSLQDIGMDHQALLKQFD 71 - 140 HLNHLNPDKFESTDLDMLIKAATSDLEHYDKTRHEEFKKYEMMKEHERREYLKTLNEEKRKEEESKFEEM 141 - 210 KKKHENHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNSDGFLDEQELEALFTKELEKVYDP 211 - 280 KNEEDDMVEMEEERLRMREHVMSEVDTNKDRLVTLEEFLKATEKKEFLEPDSWETLDQQQFFTEEELKEY 281 - 350 ENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIPPSGPAGELKFEPHI 351 - 420 //
| PMID | Year | Title |
|---|---|---|
| 26831553 | 2015 | Correlation of Brain Neuropeptide (Nesfatin-1 and Orexin-A) Concentrations with Anthropometric and Biochemical Parameters in Malnourished Children. |
| 26744860 | 2015 | Role of circulating nesfatin-1 in the underweight children with poor appetite. |
| 26624852 | 2016 | Association of the Polymorphism in Nucleobindin 2 Gene and the Risk of Metabolic Syndrome. |
| 26162003 | 2015 | NUCB2/nesfatin-1 Is Associated with Elevated Levels of Anxiety in Anorexia Nervosa. |
| 26143537 | 2015 | Sex-specific regulation of NUCB2/nesfatin-1: Differential implication in anxiety in obese men and women. |
| 25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
| 25872767 | 2015 | Serum and synovial fluid nesfatin-1 concentration is associated with radiographic severity of knee osteoarthritis. |
| 25869615 | 2015 | Nesfatin-1 inhibits proliferation and enhances apoptosis of human adrenocortical H295R cells. |
| 25841171 | 2015 | Serum nesfatin-1 is reduced in type 2 diabetes mellitus patients with peripheral arterial disease. |
| 25833360 | 2015 | Serum nesfatin-1 and leptin levels in non-obese girls with premature thelarche. |
| More... |
