Property Summary

NCBI Gene PubMed Count 28
PubMed Score 19.53
PubTator Score 24.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
breast carcinoma 1614 7.37654918575035E-23
astrocytoma 1493 6.58078696803088E-15
non-small cell lung cancer 2798 2.17580531130437E-10
Breast cancer 3099 1.65893300826592E-8
acute quadriplegic myopathy 1157 3.81960376980976E-7
ovarian cancer 8492 5.31722172906791E-7
lung cancer 4473 8.72840252417661E-7
malignant mesothelioma 3163 1.85647531360281E-6
ulcerative colitis 2087 4.13000846990242E-6
sonic hedgehog group medulloblastoma 1482 5.63292322857317E-6
osteosarcoma 7933 1.81529812201141E-5
lung adenocarcinoma 2714 9.55861203949348E-5
medulloblastoma, large-cell 6234 1.31951893118374E-4
cystic fibrosis 1670 1.78278810949581E-4
atypical teratoid/rhabdoid tumor 1095 2.64885376931836E-4
colon cancer 1475 9.00879411976707E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00222778627762652
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00233862736609398
psoriasis 6685 0.00296490747904809
glioblastoma 5572 0.0031824289920064
interstitial cystitis 2299 0.00366548409712568
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00587923411100152
invasive ductal carcinoma 2950 0.00940100269117795
cutaneous lupus erythematosus 1056 0.0134177424992913
pancreatic cancer 2300 0.015521357206572
Endometriosis 535 0.0166598732623297
esophageal adenocarcinoma 737 0.0190553920760902
primary pancreatic ductal adenocarcinoma 1271 0.0229125816355669
hereditary spastic paraplegia 313 0.0257298087931063
Down syndrome 548 0.0319799962981341
facioscapulohumeral dystrophy 286 0.0369641332905652
active Crohn's disease 918 0.0432954576138105
primitive neuroectodermal tumor 3031 0.0484628440429231

Expression

Synonym

Accession P80297 A8MUC7 MT-1X
Symbols MT1
MT-1l

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG

Gene RIF (10)

PMID Text
24690879 These findings suggest that functional interactions between FHL3 and MT-1X may provide some clues to the mechanisms of FHL3-regulated cell proliferation.
23251525 siRNA-mediated knockdown of TCRP1 and MT1X was found to sensitize cells to cisplatin, leading to increased apoptosis and inhibition of cell proliferation
22780124 Results show variation in MTX1 is implicated in disordered gambling
22108904 Our results suggest that MT1XT20 represents a sensitive and specific marker for MSI testing and could be included in a complete set of MSI markers for the confident identification of familial or sporadic dMMR patients in colorectal cancers.
20812968 MT-1A, -1F, -1G, -1X and -2A isoforms are significantly down-regulated in proliferating keloid fibroblasts.
20551211 Increases in MT gene expression and intracellular zinc levels may contribute directly to maintenance of an immune-activated monocyte by mediating an increased resistance to apoptosis during active HIV-1 viremia.
19881214 It plays a role in the detoxification of heavy metals and reactive oxygen species. (review)
19817957 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of metallothionein 1X (MT1X) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
12539042 Microarray analysis indicates HIV-1 Tat upregulates the interferon-responsive gene expression of many proteins, including Metallothionein, in immature dendritic cells, an effect that likely facilitates the expansion of HIV-1 infection

AA Sequence

MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCCA               1 - 61
//

Text Mined References (30)

PMID Year Title
24690879 2014 Identification and characterization of MT-1X as a novel FHL3-binding partner.
23251525 2012 Microarray-assisted pathway analysis identifies MT1X & NF?B as mediators of TCRP1-associated resistance to cisplatin in oral squamous cell carcinoma.
22780124 2013 Genome-wide association study of a quantitative disordered gambling trait.
22108904 2012 T([20]) repeat in the 3'-untranslated region of the MT1X gene: a marker with high sensitivity and specificity to detect microsatellite instability in colorectal cancer.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20812968 2010 Modulation of metallothionein isoforms is associated with collagen deposition in proliferating keloid fibroblasts in vitro.
20551211 2010 Increased metallothionein gene expression, zinc, and zinc-dependent resistance to apoptosis in circulating monocytes during HIV viremia.
19881214 2009 [Cilostazol induces metallothionein expression in vascular cells].
19817957 2009 Secreted protein acidic and rich in cysteine (SPARC) gene polymorphism association with hepatocellular carcinoma in Italian patients.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...