Property Summary

NCBI Gene PubMed Count 30
PubMed Score 20.10
PubTator Score 24.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (33)

Disease log2 FC p
active Crohn's disease -1.121 4.3e-02
acute quadriplegic myopathy 1.823 1.4e-05
astrocytoma 1.200 6.6e-15
atypical teratoid / rhabdoid tumor -1.900 6.0e-03
Breast cancer -1.700 1.7e-08
breast carcinoma -1.100 3.3e-05
colon cancer -1.800 3.4e-03
cutaneous lupus erythematosus -1.400 1.3e-02
cystic fibrosis 1.197 5.6e-05
Down syndrome 1.300 3.2e-02
Endometriosis -2.541 1.6e-02
esophageal adenocarcinoma -1.700 1.9e-02
facioscapulohumeral dystrophy -1.800 3.7e-02
glioblastoma 1.500 3.2e-03
group 3 medulloblastoma -2.000 1.4e-04
hereditary spastic paraplegia 1.017 2.6e-02
interstitial cystitis 1.200 3.7e-03
intraductal papillary-mucinous adenoma (... -2.400 2.3e-03
intraductal papillary-mucinous carcinoma... -2.700 5.9e-03
intraductal papillary-mucinous neoplasm ... -3.200 2.2e-03
invasive ductal carcinoma -1.300 9.4e-03
lung adenocarcinoma -1.500 9.6e-05
lung cancer -1.800 1.8e-03
malignant mesothelioma -1.400 3.6e-06
medulloblastoma, large-cell -2.900 1.3e-04
non-small cell lung cancer -1.266 2.3e-07
osteosarcoma 1.904 1.1e-04
ovarian cancer 2.600 5.3e-07
pancreatic cancer -1.200 1.3e-06
primary pancreatic ductal adenocarcinoma -1.186 4.2e-02
primitive neuroectodermal tumor -1.400 4.8e-02
psoriasis -1.400 3.0e-03
ulcerative colitis -2.400 4.1e-06

Gene RIF (12)

AA Sequence

MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCCA               1 - 61
//

Text Mined References (32)

PMID Year Title