Property Summary

NCBI Gene PubMed Count 22
PubMed Score 15.24
PubTator Score 15.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -1.230 1.8e-03
astrocytoma 1.100 5.3e-09
Astrocytoma, Pilocytic 1.500 4.3e-06
Barrett's esophagus 1.300 2.4e-02
cutaneous lupus erythematosus 2.300 1.3e-03
dermatomyositis 1.700 1.5e-02
ependymoma 1.100 1.0e-03
esophageal adenocarcinoma 1.800 1.8e-02
glioblastoma 1.100 6.5e-03
juvenile dermatomyositis 2.522 2.1e-12
lung cancer -1.500 4.8e-03
Multiple myeloma 1.704 1.8e-03
Multiple Sclerosis 1.600 2.0e-02
osteosarcoma -1.802 2.1e-03
ovarian cancer -1.900 8.8e-05
pediatric high grade glioma 1.100 6.9e-03
subependymal giant cell astrocytoma 1.223 1.1e-02
tuberculosis 1.500 2.4e-04
urothelial carcinoma -1.100 3.8e-02

Gene RIF (13)

AA Sequence

MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNL      1 - 70
RIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQMSSQLSGRRVLVTGF     71 - 140
PASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLR    141 - 210
VSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAV    211 - 280
FTSESG                                                                    281 - 286
//

Text Mined References (24)

PMID Year Title