Property Summary

NCBI Gene PubMed Count 20
Grant Count 6
R01 Count 4
Funding $649,112.72
PubMed Score 13.57
PubTator Score 15.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Multiple myeloma 1.704 0.002
urothelial carcinoma -1.100 0.038
Barrett's esophagus 1.300 0.024
esophageal adenocarcinoma 1.800 0.018
cutaneous lupus erythematosus 2.300 0.001
astrocytoma 1.100 0.000
glioblastoma 1.600 0.001
osteosarcoma -1.802 0.002
posterior fossa group A ependymoma 1.400 0.000
juvenile dermatomyositis 2.522 0.000
adrenocortical carcinoma -1.230 0.002
tuberculosis 1.500 0.000
lung cancer -1.500 0.005
Multiple Sclerosis 1.600 0.020
pediatric high grade glioma 1.100 0.007
pilocytic astrocytoma 1.500 0.000
subependymal giant cell astrocytoma 1.223 0.011
ovarian cancer -1.900 0.000
dermatomyositis 1.700 0.015

Gene RIF (12)

PMID Text
26342464 Trim21 regulates Nmi-IFI35 complex-mediated inhibition of innate antiviral response
26116899 HIV-1 Vpr upregulates the gene expression of IFI35 in human monocyte-derived dendritic cells
25085622 Knockdown of IFP35 expression abolished pEGFP-N1-2C and pEGFP-N1-Nmi-induced activation of type I interferon promoters.
24742347 HIV-1 Vpr upregulates the gene expression of IFI35 in human monocyte-derived dendritic cells
24742347 HIV-1 Vpr upregulates the gene expression of IFI35 in human monocyte-derived dendritic cells
24371060 IFI35 negatively regulates RIG-I antiviral signaling and supports vesicular stomatitis virus replication.
23226549 IRF-1 also activates IFP35 expression in an IFN-gamma-inducible manner.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
18305040 IFP35 can interact with the bovine Tas (BTas) regulatory protein of bovine foamy virus; overexpression of IFP35 disturbs the ability of BTas to activate viral-gene transcription and inhibits viral replication.
17197158 The results provide a novel role of CKIP-1 in cytokine signaling response and the biochemical mechanism, by which two previously identified modulators IFP35 and Nmi are involved via interactions.
More...

AA Sequence

MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNL      1 - 70
RIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQMSSQLSGRRVLVTGF     71 - 140
PASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLR    141 - 210
VSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAV    211 - 280
FTSESG                                                                    281 - 286
//

Text Mined References (22)

PMID Year Title
26342464 2015 Trim21 regulates Nmi-IFI35 complex-mediated inhibition of innate antiviral response.
25085622 2014 A critical role of interferon-induced protein IFP35 in the type I interferon response in cells induced by foot-and-mouth disease virus (FMDV) protein 2C.
24371060 2014 Interferon-inducible protein IFI35 negatively regulates RIG-I antiviral signaling and supports vesicular stomatitis virus replication.
23226549 2012 Interferon-? upregulates expression of IFP35 gene in HeLa cells via interferon regulatory factor-1.
21269460 2011 Initial characterization of the human central proteome.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
18624398 2008 Protein interaction data set highlighted with human Ras-MAPK/PI3K signaling pathways.
18305040 2008 IFP35 is involved in the antiviral function of interferon by association with the viral tas transactivator of bovine foamy virus.
17197158 2007 The PH domain containing protein CKIP-1 binds to IFP35 and Nmi and is involved in cytokine signaling.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
More...