Property Summary

Ligand Count 14
NCBI Gene PubMed Count 18
PubMed Score 24.70
PubTator Score 11.13

Knowledge Summary

Patent (8,846)

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma 1.402 2.2e-03
adult high grade glioma -2.700 3.2e-06
astrocytic glioma -2.400 1.4e-03
Astrocytoma, Pilocytic -2.600 2.0e-10
atypical teratoid / rhabdoid tumor -3.100 4.9e-09
colon cancer 1.300 1.2e-03
cystic fibrosis 1.136 8.3e-04
ductal carcinoma in situ 1.200 2.4e-03
ependymoma -2.400 2.4e-03
esophageal adenocarcinoma -1.400 4.3e-02
glioblastoma -2.800 2.7e-11
intraductal papillary-mucinous adenoma (... 1.300 1.5e-03
medulloblastoma -1.600 3.2e-04
medulloblastoma, large-cell -2.000 2.5e-06
oligodendroglioma -1.800 2.4e-02
primitive neuroectodermal tumor -1.700 1.4e-03
psoriasis 1.100 8.5e-22
severe Alzheimer's disease -1.138 2.4e-02
spina bifida -2.118 3.6e-02

 MGI Phenotype (1)

Gene RIF (7)

AA Sequence

MEPSRALLGCLASAAAAAPPGEDGAGAGAEEEEEEEEEAAAAVGPGELGCDAPLPYWTAVFEYEAAGEDE      1 - 70
LTLRLGDVVEVLSKDSQVSGDEGWWTGQLNQRVGIFPSNYVTPRSAFSSRCQPGGEDPSCYPPIQLLEID     71 - 140
FAELTLEEIIGIGGFGKVYRAFWIGDEVAVKAARHDPDEDISQTIENVRQEAKLFAMLKHPNIIALRGVC    141 - 210
LKEPNLCLVMEFARGGPLNRVLSGKRIPPDILVNWAVQIARGMNYLHDEAIVPIIHRDLKSSNILILQKV    211 - 280
ENGDLSNKILKITDFGLAREWHRTTKMSAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVPFR    281 - 350
GIDGLAVAYGVAMNKLALPIPSTCPEPFAKLMEDCWNPDPHSRPSFTNILDQLTTIEESGFFEMPKDSFH    351 - 420
CLQDNWKHEIQEMFDQLRAKEKELRTWEEELTRAALQQKNQEELLRRREQELAEREIDILERELNIIIHQ    421 - 490
LCQEKPRVKKRKGKFRKSRLKLKDGNRISLPSDFQHKFTVQASPTMDKRKSLINSRSSPPASPTIIPRLR    491 - 560
AIQLTPGESSKTWGRSSVVPKEEGEEEEKRAPKKKGRTWGPGTLGQKELASGDEGSPQRREKANGLSTPS    561 - 630
ESPHFHLGLKSLVDGYKQWSSSAPNLVKGPRSSPALPGFTSLMEMEDEDSEGPGSGESRLQHSPSQSYLC    631 - 700
IPFPRGEDGDGPSSDGIHEEPTPVNSATSTPQLTPTNSLKRGGAHHRRCEVALLGCGAVLAATGLGFDLL    701 - 770
EAGKCQLLPLEEPEPPAREEKKRREGLFQRSSRPRRSTSPPSRKLFKKEEPMLLLGDPSASLTLLSLSSI    771 - 840
SECNSTRSLLRSDSDEIVVYEMPVSPVEAPPLSPCTHNPLVNVRVERFKRDPNQSLTPTHVTLTTPSQPS    841 - 910
SHRRTPSDGALKPETLLASRSPSSNGLSPSPGAGMLKTPSPSRDPGEFPRLPDPNVVFPPTPRRWNTQQD    911 - 980
STLERPKTLEFLPRPRPSANRQRLDPWWFVSPSHARSTSPANSSSTETPSNLDSCFASSSSTVEERPGLP    981 - 1050
ALLPFQAGPLPPTERTLLDLDAEGQSQDSTVPLCRAELNTHRPAPYEIQQEFWS                   1051 - 1104
//

Text Mined References (25)

PMID Year Title