Property Summary

NCBI Gene PubMed Count 17
Grant Count 6
R01 Count 2
Funding $165,183.12
PubMed Score 20.70
PubTator Score 11.13

Knowledge Summary

Patent (8,846)

Expression

Synonym

Accession P80192 A3KN85 Q0D2G7 Q6EH31 Q9H2N5
Symbols MLK1
MEKK9
PRKE1

Gene

PDB

3DTC   4UY9  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (6)

PMID Text
26573018 miR148b directly targeted mitogenactivated protein kinase (MAPK) kinase kinase 9 (MAP3K9), an upstream activator of MAPK kinase/cJun Nterminal kinase (JNK) signaling, suppressing the protein but not the mRNA levels.
23836671 identified three kinases with gain-of-function mutations in lung cancer, namely FGFR4, MAP3K9, and PAK5. Mutations in these kinases are activating toward the ERK pathway, and targeted depletion of the mutated kinases inhibits proliferation
22197930 It was found that 24% of melanoma cell lines have mutations in the protein-coding regions of either MAP3K5 or MAP3K9.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19826002 estrogen receptor-alpha transcriptional activity is repressed by the Rho/megakaryoblastic leukemia 1 signaling pathway
18976975 Knockdown of mitogen-activated protein kinase kinase kinase 9 (MAP3K9) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MEPSRALLGCLASAAAAAPPGEDGAGAGAEEEEEEEEEAAAAVGPGELGCDAPLPYWTAVFEYEAAGEDE      1 - 70
LTLRLGDVVEVLSKDSQVSGDEGWWTGQLNQRVGIFPSNYVTPRSAFSSRCQPGGEDPSCYPPIQLLEID     71 - 140
FAELTLEEIIGIGGFGKVYRAFWIGDEVAVKAARHDPDEDISQTIENVRQEAKLFAMLKHPNIIALRGVC    141 - 210
LKEPNLCLVMEFARGGPLNRVLSGKRIPPDILVNWAVQIARGMNYLHDEAIVPIIHRDLKSSNILILQKV    211 - 280
ENGDLSNKILKITDFGLAREWHRTTKMSAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVPFR    281 - 350
GIDGLAVAYGVAMNKLALPIPSTCPEPFAKLMEDCWNPDPHSRPSFTNILDQLTTIEESGFFEMPKDSFH    351 - 420
CLQDNWKHEIQEMFDQLRAKEKELRTWEEELTRAALQQKNQEELLRRREQELAEREIDILERELNIIIHQ    421 - 490
LCQEKPRVKKRKGKFRKSRLKLKDGNRISLPSDFQHKFTVQASPTMDKRKSLINSRSSPPASPTIIPRLR    491 - 560
AIQLTPGESSKTWGRSSVVPKEEGEEEEKRAPKKKGRTWGPGTLGQKELASGDEGSPQRREKANGLSTPS    561 - 630
ESPHFHLGLKSLVDGYKQWSSSAPNLVKGPRSSPALPGFTSLMEMEDEDSEGPGSGESRLQHSPSQSYLC    631 - 700
IPFPRGEDGDGPSSDGIHEEPTPVNSATSTPQLTPTNSLKRGGAHHRRCEVALLGCGAVLAATGLGFDLL    701 - 770
EAGKCQLLPLEEPEPPAREEKKRREGLFQRSSRPRRSTSPPSRKLFKKEEPMLLLGDPSASLTLLSLSSI    771 - 840
SECNSTRSLLRSDSDEIVVYEMPVSPVEAPPLSPCTHNPLVNVRVERFKRDPNQSLTPTHVTLTTPSQPS    841 - 910
SHRRTPSDGALKPETLLASRSPSSNGLSPSPGAGMLKTPSPSRDPGEFPRLPDPNVVFPPTPRRWNTQQD    911 - 980
STLERPKTLEFLPRPRPSANRQRLDPWWFVSPSHARSTSPANSSSTETPSNLDSCFASSSSTVEERPGLP    981 - 1050
ALLPFQAGPLPPTERTLLDLDAEGQSQDSTVPLCRAELNTHRPAPYEIQQEFWS                   1051 - 1104
//

Text Mined References (24)

PMID Year Title
26573018 2016 MicroRNA-148b enhances proliferation and apoptosis in human renal cancer cells via directly targeting MAP3K9.
23836671 2013 Targeted genetic dependency screen facilitates identification of actionable mutations in FGFR4, MAP3K9, and PAK5 in lung cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22197930 2011 Frequent somatic mutations in MAP3K5 and MAP3K9 in metastatic melanoma identified by exome sequencing.
21107309 2011 Genome-wide pharmacogenomic study of neurocognition as an indicator of antipsychotic treatment response in schizophrenia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19826002 2009 Repression of the estrogen receptor-alpha transcriptional activity by the Rho/megakaryoblastic leukemia 1 signaling pathway.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18714982 2008 Mixed-lineage kinase 1 and mixed-lineage kinase 3 subtype-selective dihydronaphthyl[3,4-a]pyrrolo[3,4-c]carbazole-5-ones: optimization, mixed-lineage kinase 1 crystallography, and oral in vivo activity in 1-methyl-4-phenyltetrahydropyridine models.
More...