Property Summary

NCBI Gene PubMed Count 487
Grant Count 281
R01 Count 103
Funding $35,949,169.08
PubMed Score 2128.77
PubTator Score 1235.25

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P80188 A6NII8 B4DWV4 B7ZAA2 P30150 Q5SYV9 Q5SYW0 Q6FGL5 Q92683 NGAL
Symbols p25
24p3
MSFI
NGAL

Gene

PANTHER Protein Class (1)

PDB

4GH7   4QAE   4MVI   4MVK   4MVL   1DFV   1L6M   1NGL   1QQS   1X71   1X89   1X8U   3BY0   3CBC   3CMP   3DSZ   3DTQ   3FW4   3FW5   3HWD   3HWE   3HWF   3HWG   3I0A   3K3L   3PEC   3PED   3T1D   3TF6   3TZS   3U03   3U0D   4IAW   4IAX   4K19   4ZFX   4ZHC   4ZHD   4ZHF   4ZHG   4ZHH  

Gene RIF (455)

PMID Text
27012045 Serum NGAL may be used as an early predictor of recovery of post-transplant graft function after living donor kidney transplantation.
26968114 The ability of EGCG to mediate its inhibitory activity is counter-regulated by the presence of iron and lipocalin 2
26773532 EMMPRIN, MMP8, hyaluronan, beta-defensing-2, and neutrophil gelatinase-associated lipocalin (NGAL) are elevated in women with vaginal inflammation
26757915 Iron depletion strategy for targeted cancer therapy: utilizing the dual roles of neutrophil gelatinase-associated lipocalin protein.
26673824 Data show that kidney injury molecule (KIM)-1 and neutrophil gelatinase-associated lipocalin (NGAL), were significantly elevated in welding workers post-exposure.
26635366 Biochemical and Structural Characterization of the Interaction between the Siderocalin NGAL/LCN2 (Neutrophil Gelatinase-associated Lipocalin/Lipocalin 2) and the N-terminal Domain of Its Endocytic Receptor SLC22A17.
26632077 findings suggest that both NGAL and CysC are very sensitive markers that reflect renal impairment in newly diagnosed patients with multiple myeloma.
26629810 role of NGAL in leptospirosis acute kidney injury
26627265 children with heart failure caused by idiopathic dilated cardiomyopathy had significantly higher plasma NGAL levels than healthy controls
26626454 plasma NGAL is a valuable biological marker in the assessment of severity and prediction of prognosis of patients with sepsis
More...

AA Sequence

MPLGLLWLGLALLGALHAQAQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQK      1 - 70
MYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAM     71 - 140
VFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG                141 - 198
//

Text Mined References (494)

PMID Year Title
27012045 2016 Serum Neutrophil Gelatinase-Associated Lipocalin and Cystatin C for Assessing Recovery of Graft Function in Patients Undergoing Living-Donor Kidney Transplantation.
26968114 2016 Epigallocatechin-3-Gallate Inhibition of Myeloperoxidase and Its Counter-Regulation by Dietary Iron and Lipocalin 2 in Murine Model of Gut Inflammation.
26773532 2016 Vaginal Inflammation: Association between Leukocyte Concentration and Levels of Immune Mediators.
26757915 2016 Iron depletion strategy for targeted cancer therapy: utilizing the dual roles of neutrophil gelatinase-associated lipocalin protein.
26673824 2015 Urinary neutrophil gelatinase-associated lipocalin is associated with heavy metal exposure in welding workers.
26635366 2016 Biochemical and Structural Characterization of the Interaction between the Siderocalin NGAL/LCN2 (Neutrophil Gelatinase-associated Lipocalin/Lipocalin 2) and the N-terminal Domain of Its Endocytic Receptor SLC22A17.
26632077 2016 Neutrophil Gelatinase--Associated Lipocalin and Cystatin C Are Sensitive Markers of Renal Injury in Patients With Multiple Myeloma.
26629810 2015 Neutrophil Gelatinase Associated Lipocalin (NGAL) in Leptospirosis Acute Kidney Injury: A Multicenter Study in Thailand.
26627265 2016 Plasma levels of neutrophil gelatinase-associated lipocalin in children with heart failure.
26626454 2016 Value of plasma neutrophil gelatinase-associated lipocalin in predicting the mortality of patients with sepsis at the emergency department.
More...