Property Summary

NCBI Gene PubMed Count 561
PubMed Score 2368.12
PubTator Score 1235.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

Gene RIF (528)

AA Sequence

MPLGLLWLGLALLGALHAQAQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQK      1 - 70
MYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAM     71 - 140
VFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG                141 - 198
//

Text Mined References (568)

PMID Year Title