Property Summary

NCBI Gene PubMed Count 42
PubMed Score 60.29
PubTator Score 53.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 8.44044901687514E-58
periodontitis 269 4.19140421973248E-25
malignant mesothelioma 3163 6.02036201818616E-10
ulcerative colitis 2087 9.24793862942649E-9
ovarian cancer 8492 3.3714776342109E-8
non-small cell lung cancer 2798 7.75060393898081E-7
posterior fossa group A ependymoma 1511 1.78601925499026E-6
interstitial cystitis 2299 3.47702781794001E-5
cystic fibrosis 1670 4.40960818394673E-5
atypical teratoid/rhabdoid tumor 1095 0.00555876693615973
invasive ductal carcinoma 2950 0.00624065023647717
non primary Sjogren syndrome sicca 840 0.0139887091785205
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0214471446590445
chronic kidney disease 90 0.0373951613243573
Disease Target Count Z-score Confidence
Mastitis 48 3.156 1.6

Expression

Synonym

Accession P80162 B2R4X3 Q4W5D4
Symbols GCP2
CKA-3
GCP-2
SCYB6

Gene

  Ortholog (2)

Species Source
Chimp OMA EggNOG
Pig OMA Inparanoid

Gene RIF (26)

PMID Text
26728495 This is the first study to note that elevated systemic CCL5 and CXCL6 were associated with moderate/severe lumbar disc degeneration. These chemokines may be systemic biomarkers for the diagnosis and monitoring of disc degeneration.
25993443 The neutrophil-recruiting chemokine GCP-2/CXCL6 is expressed in cystic fibrosis airways and retains its functional properties after binding to extracellular DNA.
25323032 HIF-1alpha promotes HCC progression and metastasis by upregulating CXCL6 transcription in HCC cells.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of chemokine (C-X-C motif) ligand 6 (CXCL6) in primary human brain microvascular endothelial cells
24250750 Expression of the CXCL8, CXCL6 and CXCL1 genes are under the primary control of 1,25-dihydroxyvitamin D3 and its receptor.
23814098 Data suggest that expression of CXCL6 in trophoblasts is up-regulated during pregnancy development/placentation; CXCL6 expression inhibits trophoblast cell migration and invasion by down-regulating activity of MMP2 (matrix metalloproteinase 2).
23383108 Microarray analysis indicates HIV-1 Tat-induced upregulation of chemokine (C-X-C motif) ligand 6 (CXCL6) in primary human brain microvascular endothelial cells
22886775 Overexpression of GCP-2 in mesenchymal stem cells has the potential to enhance their angiogenic and survival properties.
21236563 Studies show that functional blocking of GCP-2 inhibits tumor growth and metastases.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFP      1 - 70
AGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN                               71 - 114
//

Text Mined References (43)

PMID Year Title
26728495 2016 Systemic blood plasma CCL5 and CXCL6: Potential biomarkers for human lumbar disc degeneration.
25993443 2016 The neutrophil-recruiting chemokine GCP-2/CXCL6 is expressed in cystic fibrosis airways and retains its functional properties after binding to extracellular DNA.
25323032 2014 HIF-1? plays a role in the chemotactic migration of hepatocarcinoma cells through the modulation of CXCL6 expression.
24250750 2013 Primary 1,25-dihydroxyvitamin D3 response of the interleukin 8 gene cluster in human monocyte- and macrophage-like cells.
23814098 2013 The chemokine CXCL6 restricts human trophoblast cell migration and invasion by suppressing MMP-2 activity in the first trimester.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22886775 2012 Mesenchymal stem cells overexpressing GCP-2 improve heart function through enhanced angiogenic properties in a myocardial infarction model.
21236563 2011 Isotypic neutralizing antibodies against mouse GCP-2/CXCL6 inhibit melanoma growth and metastasis.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20507572 2010 Differential cytokine regulation by NF-kappaB and AP-1 in Jurkat T-cells.
More...