Property Summary

NCBI Gene PubMed Count 44
PubMed Score 66.63
PubTator Score 53.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 2.100 5.6e-03
chronic kidney disease 2.200 3.7e-02
cystic fibrosis 2.500 4.1e-03
ependymoma 2.600 2.7e-04
interstitial cystitis 2.700 8.9e-03
intraductal papillary-mucinous adenoma (... -1.600 2.1e-02
invasive ductal carcinoma -2.310 6.2e-03
malignant mesothelioma -7.500 6.0e-10
non primary Sjogren syndrome sicca -1.400 1.4e-02
non-small cell lung cancer 2.074 7.8e-07
ovarian cancer -4.100 3.4e-08
periodontitis 2.000 4.2e-25
psoriasis 5.100 8.4e-58
ulcerative colitis 5.400 9.2e-09

Protein-protein Interaction (1)

Gene RIF (28)

AA Sequence

MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFP      1 - 70
AGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN                               71 - 114
//

Text Mined References (45)

PMID Year Title