Property Summary

NCBI Gene PubMed Count 42
Grant Count 3
R01 Count 3
Funding $243,383
PubMed Score 60.29
PubTator Score 53.61

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P80162 B2R4X3 Q4W5D4
Symbols GCP2
CKA-3
GCP-2
SCYB6

Gene

Gene RIF (26)

PMID Text
26728495 This is the first study to note that elevated systemic CCL5 and CXCL6 were associated with moderate/severe lumbar disc degeneration. These chemokines may be systemic biomarkers for the diagnosis and monitoring of disc degeneration.
25993443 The neutrophil-recruiting chemokine GCP-2/CXCL6 is expressed in cystic fibrosis airways and retains its functional properties after binding to extracellular DNA.
25323032 HIF-1alpha promotes HCC progression and metastasis by upregulating CXCL6 transcription in HCC cells.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of chemokine (C-X-C motif) ligand 6 (CXCL6) in primary human brain microvascular endothelial cells
24250750 Expression of the CXCL8, CXCL6 and CXCL1 genes are under the primary control of 1,25-dihydroxyvitamin D3 and its receptor.
23814098 Data suggest that expression of CXCL6 in trophoblasts is up-regulated during pregnancy development/placentation; CXCL6 expression inhibits trophoblast cell migration and invasion by down-regulating activity of MMP2 (matrix metalloproteinase 2).
23383108 Microarray analysis indicates HIV-1 Tat-induced upregulation of chemokine (C-X-C motif) ligand 6 (CXCL6) in primary human brain microvascular endothelial cells
22886775 Overexpression of GCP-2 in mesenchymal stem cells has the potential to enhance their angiogenic and survival properties.
21236563 Studies show that functional blocking of GCP-2 inhibits tumor growth and metastases.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFP      1 - 70
AGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN                               71 - 114
//

Text Mined References (43)

PMID Year Title
26728495 2016 Systemic blood plasma CCL5 and CXCL6: Potential biomarkers for human lumbar disc degeneration.
25993443 2016 The neutrophil-recruiting chemokine GCP-2/CXCL6 is expressed in cystic fibrosis airways and retains its functional properties after binding to extracellular DNA.
25323032 2014 HIF-1? plays a role in the chemotactic migration of hepatocarcinoma cells through the modulation of CXCL6 expression.
24250750 2013 Primary 1,25-dihydroxyvitamin D3 response of the interleukin 8 gene cluster in human monocyte- and macrophage-like cells.
23814098 2013 The chemokine CXCL6 restricts human trophoblast cell migration and invasion by suppressing MMP-2 activity in the first trimester.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22886775 2012 Mesenchymal stem cells overexpressing GCP-2 improve heart function through enhanced angiogenic properties in a myocardial infarction model.
21236563 2011 Isotypic neutralizing antibodies against mouse GCP-2/CXCL6 inhibit melanoma growth and metastasis.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20507572 2010 Differential cytokine regulation by NF-kappaB and AP-1 in Jurkat T-cells.
More...