Property Summary

NCBI Gene PubMed Count 55
PubMed Score 126.81
PubTator Score 716.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.100 3.3e-02
astrocytic glioma 1.300 3.9e-02
Atopic dermatitis -2.100 1.9e-04
cutaneous lupus erythematosus -1.600 1.6e-02
glioblastoma -1.600 1.7e-04
lung cancer 1.200 2.5e-02
lung carcinoma 1.100 2.6e-17
medulloblastoma, large-cell -1.700 7.5e-04
non primary Sjogren syndrome sicca -1.200 1.8e-02
oligodendroglioma 1.700 1.7e-03
osteosarcoma -1.013 2.7e-04
ovarian cancer -1.200 8.0e-06
pituitary cancer 1.300 3.7e-03
psoriasis -2.200 3.2e-05
subependymal giant cell astrocytoma -2.670 1.3e-02

Gene RIF (29)

AA Sequence

MSAFRLWPGLLIMLGSLCHRGSPCGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAYQAGIVFPDCF      1 - 70
YPSICKGGKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQG     71 - 140
FLRTMGAIDFHGSYSEAHSAGDFGGDVLSQFEFNFNYLARRWYVPVKDLLGIYEKLYGRKVITENVIVDC    141 - 210
SHIQFLEMYGEMLAVSKLYPTYSTKSPFLVEQFQEYFLGGLDDMAFWSTNIYHLTSFMLENGTSDCNLPE    211 - 280
NPLFIACGGQQNHTQGSKMQKNDFHRNLTTSLTESVDRNINYTERGVFFSVNSWTPDSMSFIYKALERNI    281 - 350
RTMFIGGSQLSQKHVSSPLASYFLSFPYARLGWAMTSADLNQDGHGDLVVGAPGYSRPGHIHIGRVYLIY    351 - 420
GNDLGLPPVDLDLDKEAHRILEGFQPSGRFGSALAVLDFNVDGVPDLAVGAPSVGSEQLTYKGAVYVYFG    421 - 490
SKQGGMSSSPNITISCQDIYCNLGWTLLAADVNGDSEPDLVIGSPFAPGGGKQKGIVAAFYSGPSLSDKE    491 - 560
KLNVEAANWTVRGEEDFSWFGYSLHGVTVDNRTLLLVGSPTWKNASRLGHLLHIRDEKKSLGRVYGYFPP    561 - 630
NGQSWFTISGDKAMGKLGTSLSSGHVLMNGTLKQVLLVGAPTYDDVSKVAFLTVTLHQGGATRMYALTSD    631 - 700
AQPLLLSTFSGDRRFSRFGGVLHLSDLDDDGLDEIIMAAPLRIADVTSGLIGGEDGRVYVYNGKETTLGD    701 - 770
MTGKCKSWITPCPEEKAQYVLISPEASSRFGSSLITVRSKAKNQVVIAAGRSSLGARLSGALHVYSLGSD    771 - 840
//

Text Mined References (56)

PMID Year Title