Property Summary

NCBI Gene PubMed Count 53
PubMed Score 125.16
PubTator Score 716.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 2.63551704440709E-17
osteosarcoma 7933 2.06312889774756E-6
ovarian cancer 8492 8.00838813293947E-6
psoriasis 6685 5.42276926974428E-5
glioblastoma 5572 1.74362395527715E-4
Atopic dermatitis 944 1.86178525016945E-4
medulloblastoma, large-cell 6234 7.47090089538771E-4
pediatric high grade glioma 2712 0.00110415995660611
oligodendroglioma 2849 0.00169942053496658
pituitary cancer 1972 0.00367515206167324
subependymal giant cell astrocytoma 2287 0.0125018233648061
cutaneous lupus erythematosus 1056 0.0160606600257008
non primary Sjogren syndrome sicca 840 0.0177036150523076
lung cancer 4473 0.0247693957629987
astrocytic glioma 2241 0.0386473405370195
Disease Target Count Z-score Confidence
Atypical autism 25 3.12 1.6

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.300 0.039
oligodendroglioma 1.700 0.002
cutaneous lupus erythematosus -1.600 0.016
psoriasis 2.700 0.000
osteosarcoma -1.951 0.000
glioblastoma -1.600 0.000
medulloblastoma, large-cell -1.700 0.001
Atopic dermatitis -2.100 0.000
lung cancer 1.200 0.025
pediatric high grade glioma -1.300 0.001
non primary Sjogren syndrome sicca -1.200 0.018
subependymal giant cell astrocytoma -2.670 0.013
lung carcinoma 1.100 0.000
ovarian cancer -1.200 0.000
pituitary cancer 1.300 0.004

Synonym

Accession P80108 Q15127 Q15128 Q2M2F2 Q5T3Y0 Q7Z6T8 Q8TCV0 Q8WW82 Q96ID6 Q9H167 Q9H4M1 Q9UJC9 PI-G PLD
Symbols PLD
GPIPLD
PIGPLD
GPIPLDM
PIGPLD1

Gene

  Ortholog (10)

Gene RIF (27)

PMID Text
26567912 Low aggressive MCF-7 breast cancer cells have low endogenous PLD enzymatic activity and cell invasion, concomitant with high expression of miR-203, -887, and -3619 and miR-182 and miR-182.
26341143 An observed increase in PLD activity was mediated through boosting the binding of PLD with dynamin which in turn facilitated fibronectin-induced cell spreading.
25964559 our findings showed that ANRIL is an lncRNA responsible in anti-tumorigenesis caused by PLD inhibition and combined incorporation of ANRIL into PLD inhibition-induced anti-tumorigenic signaling network
25867459 suggest that the down-regulation of GPI-PLD protein may be involved in prion propagation in the brains of prion diseases
25632961 AMPK suppresses PLD activity, and PLD suppresses AMPK via mTOR.
24990954 At the cellular level, PLD and its reaction product, phosphatidate, interact with a large number of protein partners that are directly related to the actin cytoskeleton and cell migration.
24990952 Phospholipase D and the maintenance of phosphatidic acid levels for regulation of mammalian target of rapamycin (mTOR).
24990948 Functional regulation of phospholipase D expression in cancer and inflammation.
24956203 PLD1 and PLD2 mutants inhibit very-low-density lipoprotein-induced aldosterone production in HAC15 cells.
22481092 This study indicated that PLD participates in the same signaling pathway in this breast cancer cell line.
More...

AA Sequence

MSAFRLWPGLLIMLGSLCHRGSPCGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAYQAGIVFPDCF      1 - 70
YPSICKGGKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQG     71 - 140
FLRTMGAIDFHGSYSEAHSAGDFGGDVLSQFEFNFNYLARRWYVPVKDLLGIYEKLYGRKVITENVIVDC    141 - 210
SHIQFLEMYGEMLAVSKLYPTYSTKSPFLVEQFQEYFLGGLDDMAFWSTNIYHLTSFMLENGTSDCNLPE    211 - 280
NPLFIACGGQQNHTQGSKMQKNDFHRNLTTSLTESVDRNINYTERGVFFSVNSWTPDSMSFIYKALERNI    281 - 350
RTMFIGGSQLSQKHVSSPLASYFLSFPYARLGWAMTSADLNQDGHGDLVVGAPGYSRPGHIHIGRVYLIY    351 - 420
GNDLGLPPVDLDLDKEAHRILEGFQPSGRFGSALAVLDFNVDGVPDLAVGAPSVGSEQLTYKGAVYVYFG    421 - 490
SKQGGMSSSPNITISCQDIYCNLGWTLLAADVNGDSEPDLVIGSPFAPGGGKQKGIVAAFYSGPSLSDKE    491 - 560
KLNVEAANWTVRGEEDFSWFGYSLHGVTVDNRTLLLVGSPTWKNASRLGHLLHIRDEKKSLGRVYGYFPP    561 - 630
NGQSWFTISGDKAMGKLGTSLSSGHVLMNGTLKQVLLVGAPTYDDVSKVAFLTVTLHQGGATRMYALTSD    631 - 700
AQPLLLSTFSGDRRFSRFGGVLHLSDLDDDGLDEIIMAAPLRIADVTSGLIGGEDGRVYVYNGKETTLGD    701 - 770
MTGKCKSWITPCPEEKAQYVLISPEASSRFGSSLITVRSKAKNQVVIAAGRSSLGARLSGALHVYSLGSD    771 - 840
//

Text Mined References (54)

PMID Year Title
26567912 2016 Down-regulation of MicroRNAs (MiRs) 203, 887, 3619 and 182 Prevents Vimentin-triggered, Phospholipase D (PLD)-mediated Cancer Cell Invasion.
26341143 2015 GTP-dependent interaction between phospholipase D and dynamin modulates fibronectin-induced cell spreading.
25964559 2015 Down-regulation of Phospholipase D Stimulates Death of Lung Cancer Cells Involving Up-regulation of the Long ncRNA ANRIL.
25867459 2015 Phosphatidylinositol-glycan-phospholipase D is involved in neurodegeneration in prion disease.
25632961 2015 Reciprocal regulation of AMP-activated protein kinase and phospholipase D.
24990954 2014 Thematic minireview series on phospholipase D and cancer.
24990952 2014 Phospholipase D and the maintenance of phosphatidic acid levels for regulation of mammalian target of rapamycin (mTOR).
24990948 2014 Functional regulation of phospholipase D expression in cancer and inflammation.
24956203 2014 Phospholipase D activity underlies very-low-density lipoprotein (VLDL)-induced aldosterone production in adrenal glomerulosa cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...