Property Summary

NCBI Gene PubMed Count 53
Grant Count 6
R01 Count 1
Funding $2,083,810
PubMed Score 125.16
PubTator Score 716.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.300 0.039
oligodendroglioma 1.700 0.002
cutaneous lupus erythematosus -1.600 0.016
psoriasis 2.700 0.000
osteosarcoma -1.951 0.000
glioblastoma -1.600 0.000
medulloblastoma, large-cell -1.700 0.001
Atopic dermatitis -2.100 0.000
lung cancer 1.200 0.025
pediatric high grade glioma -1.300 0.001
non primary Sjogren syndrome sicca -1.200 0.018
subependymal giant cell astrocytoma -2.670 0.013
lung carcinoma 1.100 0.000
ovarian cancer -1.200 0.000
pituitary cancer 1.300 0.004

Gene RIF (27)

PMID Text
26567912 Low aggressive MCF-7 breast cancer cells have low endogenous PLD enzymatic activity and cell invasion, concomitant with high expression of miR-203, -887, and -3619 and miR-182 and miR-182.
26341143 An observed increase in PLD activity was mediated through boosting the binding of PLD with dynamin which in turn facilitated fibronectin-induced cell spreading.
25964559 our findings showed that ANRIL is an lncRNA responsible in anti-tumorigenesis caused by PLD inhibition and combined incorporation of ANRIL into PLD inhibition-induced anti-tumorigenic signaling network
25867459 suggest that the down-regulation of GPI-PLD protein may be involved in prion propagation in the brains of prion diseases
25632961 AMPK suppresses PLD activity, and PLD suppresses AMPK via mTOR.
24990954 At the cellular level, PLD and its reaction product, phosphatidate, interact with a large number of protein partners that are directly related to the actin cytoskeleton and cell migration.
24990952 Phospholipase D and the maintenance of phosphatidic acid levels for regulation of mammalian target of rapamycin (mTOR).
24990948 Functional regulation of phospholipase D expression in cancer and inflammation.
24956203 PLD1 and PLD2 mutants inhibit very-low-density lipoprotein-induced aldosterone production in HAC15 cells.
22481092 This study indicated that PLD participates in the same signaling pathway in this breast cancer cell line.
More...

AA Sequence

MSAFRLWPGLLIMLGSLCHRGSPCGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAYQAGIVFPDCF      1 - 70
YPSICKGGKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQG     71 - 140
FLRTMGAIDFHGSYSEAHSAGDFGGDVLSQFEFNFNYLARRWYVPVKDLLGIYEKLYGRKVITENVIVDC    141 - 210
SHIQFLEMYGEMLAVSKLYPTYSTKSPFLVEQFQEYFLGGLDDMAFWSTNIYHLTSFMLENGTSDCNLPE    211 - 280
NPLFIACGGQQNHTQGSKMQKNDFHRNLTTSLTESVDRNINYTERGVFFSVNSWTPDSMSFIYKALERNI    281 - 350
RTMFIGGSQLSQKHVSSPLASYFLSFPYARLGWAMTSADLNQDGHGDLVVGAPGYSRPGHIHIGRVYLIY    351 - 420
GNDLGLPPVDLDLDKEAHRILEGFQPSGRFGSALAVLDFNVDGVPDLAVGAPSVGSEQLTYKGAVYVYFG    421 - 490
SKQGGMSSSPNITISCQDIYCNLGWTLLAADVNGDSEPDLVIGSPFAPGGGKQKGIVAAFYSGPSLSDKE    491 - 560
KLNVEAANWTVRGEEDFSWFGYSLHGVTVDNRTLLLVGSPTWKNASRLGHLLHIRDEKKSLGRVYGYFPP    561 - 630
NGQSWFTISGDKAMGKLGTSLSSGHVLMNGTLKQVLLVGAPTYDDVSKVAFLTVTLHQGGATRMYALTSD    631 - 700
AQPLLLSTFSGDRRFSRFGGVLHLSDLDDDGLDEIIMAAPLRIADVTSGLIGGEDGRVYVYNGKETTLGD    701 - 770
MTGKCKSWITPCPEEKAQYVLISPEASSRFGSSLITVRSKAKNQVVIAAGRSSLGARLSGALHVYSLGSD    771 - 840
//

Text Mined References (54)

PMID Year Title
26567912 2016 Down-regulation of MicroRNAs (MiRs) 203, 887, 3619 and 182 Prevents Vimentin-triggered, Phospholipase D (PLD)-mediated Cancer Cell Invasion.
26341143 2015 GTP-dependent interaction between phospholipase D and dynamin modulates fibronectin-induced cell spreading.
25964559 2015 Down-regulation of Phospholipase D Stimulates Death of Lung Cancer Cells Involving Up-regulation of the Long ncRNA ANRIL.
25867459 2015 Phosphatidylinositol-glycan-phospholipase D is involved in neurodegeneration in prion disease.
25632961 2015 Reciprocal regulation of AMP-activated protein kinase and phospholipase D.
24990954 2014 Thematic minireview series on phospholipase D and cancer.
24990952 2014 Phospholipase D and the maintenance of phosphatidic acid levels for regulation of mammalian target of rapamycin (mTOR).
24990948 2014 Functional regulation of phospholipase D expression in cancer and inflammation.
24956203 2014 Phospholipase D activity underlies very-low-density lipoprotein (VLDL)-induced aldosterone production in adrenal glomerulosa cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...