Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.71
PubTator Score 0.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3232 5.6e-08
group 3 medulloblastoma 4104 2.8e-04
osteosarcoma 7950 3.0e-04
lung cancer 4740 1.5e-03

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.500 2.8e-04
lung cancer 1.700 1.5e-03
malignant mesothelioma 2.200 5.6e-08
osteosarcoma 1.181 3.0e-04

Gene RIF (2)

AA Sequence

MPKRKKQNHHQPPTQQQPPLPEREETGDEEDGSPIGPPSLLGPPPMANGKPGDPKSALHRGPPGSRGPLI      1 - 70
PPLLSLPPPPWGRGPIRRGLGPRSSPYGRGWWGVNAEPPFPGPGHGGPTRGSFHKEQRNPRRLKSWSLIK     71 - 140
NTCPPKDDPQVMEDKSDRPVCRHFAKKGHCRYEDLCAFYHPGVNGPPL                          141 - 188
//

Text Mined References (11)

PMID Year Title