Property Summary

NCBI Gene PubMed Count 154
PubMed Score 0.00
PubTator Score 579.43

Knowledge Summary

Patent

No data available

Gene RIF (144)

PMID Text
26740600 HLA-DRB3 affects type 1 diabetes risk and islet autoantibodies.
26475924 this mouse model unravels a critical role for HLA-DR3 in generating an autoimmune response to SmD and lupus nephritis in the NZM2328 background.
25240755 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
24988556 Children with the HLA haplotype DR3-DQ2, especially homozygotes, were found to be at high risk for celiac disease autoimmunity and celiac disease early in childhood.
24628273 Haplotyping was done on 91 Southern Europe celiac patients. HLA-DR3-DQ2 without HLA-DR7-DQ2 was present in 62.6%, HLA-DR7-DQ2 without HLA-DR3-DQ2 was present in 16.5% and HLA-DR4-DQ8 without HLA-DQ2 was present in 3.3%.
24505475 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
23742216 The unusual DRB1*08:01 haplotype carrying DRB3*02:02 has been confirmed in a Dutch family.
23729440 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
23596045 Prospective evaluation of matching for HLA-DRB3/4/5, -DQ, and -DP loci is warranted to reduce posttransplant risks in donor-recipient pairs matched for 7/8 HEL.
23462545 HLA-DRB3*02:02 on the DRB1*03:01 haplotype can contribute to type 1 diabetes risk.
More...

AA Sequence

MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFD      1 - 70
SDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQH     71 - 140
HNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVT    141 - 210
SALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS                  211 - 266
//

Text Mined References (168)

PMID Year Title
26740600 2016 Next-Generation Sequencing Reveals That HLA-DRB3, -DRB4, and -DRB5 May Be Associated With Islet Autoantibodies and Risk for Childhood Type 1 Diabetes.
26475924 2015 A Central Role for HLA-DR3 in Anti-Smith Antibody Responses and Glomerulonephritis in a Transgenic Mouse Model of Spontaneous Lupus.
24988556 2014 Risk of pediatric celiac disease according to HLA haplotype and country.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24628273 2014 Paediatric celiac patients carrying the HLA-DR7-DQ2 and HLA-DR3-DQ2 haplotypes display small clinical differences.
23742216 2013 The unusual DRB1*08:01 haplotype carrying DRB3*02:02 confirmed in a Dutch family.
23596045 2013 Multiple mismatches at the low expression HLA loci DP, DQ, and DRB3/4/5 associate with adverse outcomes in hematopoietic stem cell transplantation.
23462545 2013 Next generation sequencing reveals the association of DRB3*02:02 with type 1 diabetes.
23387390 2013 Genomic evaluation of HLA-DR3+ haplotypes associated with type 1 diabetes.
23010279 2013 Analysis of HLA-DRB3 alleles and supertypical genotypes in the MHC Class II region in sporadic inclusion body myositis.
More...