Property Summary

Ligand Count 10
NCBI Gene PubMed Count 157
PubMed Score 0.00
PubTator Score 579.43

Knowledge Summary

Patent

No data available

Protein-protein Interaction (4)

Gene RIF (142)

AA Sequence

MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFD      1 - 70
SDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQH     71 - 140
HNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVT    141 - 210
SALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS                  211 - 266
//

Text Mined References (171)

PMID Year Title