Property Summary

NCBI Gene PubMed Count 59
PubMed Score 113.89
PubTator Score 226.82

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count
Polycystic Ovary Syndrome 335
Disease Target Count P-value
non-small cell lung cancer 2798 2.99765295652231E-23
lung carcinoma 2844 3.23212465441167E-17
oligodendroglioma 2849 1.08719340142895E-12
atypical teratoid / rhabdoid tumor 4369 5.21801627119034E-10
lung adenocarcinoma 2714 5.23528983872031E-10
juvenile dermatomyositis 1189 5.78754856250252E-9
adult high grade glioma 2148 2.21215390140681E-8
pilocytic astrocytoma 3086 1.31004824122168E-6
ovarian cancer 8492 2.22405117474125E-6
tuberculosis and treatment for 3 months 327 2.67210651075249E-6
glioblastoma 5572 3.66124563422442E-6
ependymoma 2514 1.30955473814735E-5
lung cancer 4473 1.44658063003944E-5
Waldenstrons macroglobulinemia 765 1.63701106470556E-5
primitive neuroectodermal tumor 3031 2.47817082710035E-5
Amyotrophic Lateral Sclerosis 432 3.34534944147364E-5
acute quadriplegic myopathy 1157 4.19791879411417E-4
cystic fibrosis 1670 7.97374778232128E-4
medulloblastoma, large-cell 6234 8.56677546006875E-4
astrocytic glioma 2241 0.00271055774237212
group 4 medulloblastoma 1875 0.00425521452788789
osteosarcoma 7933 0.0121875055567341
dermatomyositis 967 0.0135841321255284
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 147 0.0 1.0
Disease Target Count Z-score Confidence
Contact Dermatitis 80 3.707 1.9
Spindle cell hemangioma 16 3.115 1.6


  Differential Expression (23)

Disease log2 FC p
Waldenstrons macroglobulinemia -2.593 0.000
astrocytic glioma -2.100 0.003
glioblastoma -2.600 0.000
oligodendroglioma -1.200 0.000
osteosarcoma -1.647 0.012
ependymoma -1.300 0.000
atypical teratoid / rhabdoid tumor -2.800 0.000
medulloblastoma, large-cell -1.200 0.001
primitive neuroectodermal tumor -1.900 0.000
juvenile dermatomyositis -1.060 0.000
Amyotrophic Lateral Sclerosis -1.166 0.000
acute quadriplegic myopathy 1.263 0.000
tuberculosis and treatment for 3 months 1.700 0.000
non-small cell lung cancer -2.402 0.000
lung cancer -3.000 0.000
cystic fibrosis 1.100 0.001
lung adenocarcinoma -2.154 0.000
adult high grade glioma -2.600 0.000
group 4 medulloblastoma -1.100 0.004
pilocytic astrocytoma -1.400 0.000
lung carcinoma -1.800 0.000
ovarian cancer 2.800 0.000
dermatomyositis 1.300 0.014



1ZY7   5ED1   5ED2   5HP2   5HP3  

  Ortholog (11)

Gene RIF (43)

26712564 These data suggest that, like ADAR2, underlying sequences in dsRNA may influence how NF90 recognizes its target RNAs
26655226 A-to-I RNA editing levels catalyzed by ADAR1 and ADARB1 decreased in Alzheimer's disease patients' brain tissues, mainly in the hippocampus and to a lesser degree in the temporal and frontal lobes.
26485095 These findings suggest that adenosine deaminase acting on RNA 2 is subject to different regulations by DNA methyltransferase and histone deacetylase enzymes in neuronal SH-SY5Y cells.
26252972 Detailed structural analysis indicates that the minor groove width of dsRNA and global shape of RNA may play an important role in the specific reading mechanism of ADAR2.
25873329 we conclude that this aberrant alternative splicing pattern of ADAR2 downregulates A-to-I editing in glioma
25732952 ADARB1 rs9983925 and rs4819035 and HTR2C rs6318 were associated with suicide attempt risk.
25692240 Data show that a large fraction of the edited genes are positively correlated ADAR (ADAR1) and ADARB1 (ADAR2).
25673044 Therefore, the expression of ADAR1 and ADAR2 was analyzed in chordoma tissues. It was found that ADAR1 was significantly overexpressed, which was accompanied by enhanced pre-miR-10a and pri-miR-125a A-to-I editing
25582055 ADAR2 is a key factor for maintaining edited-miRNA population and balancing the expression of several essential miRNAs involved in cancer.
25564529 Characterization of the ADAR2 catalytic domain-RNA interaction.

AA Sequence

SKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLTP                                 701 - 741

Text Mined References (72)

PMID Year Title
26712564 2016 Nuclear factor 90 uses an ADAR2-like binding mode to recognize specific bases in dsRNA.
26655226 2016 Reduced levels of protein recoding by A-to-I RNA editing in Alzheimer's disease.
26485095 2015 Differential regulation of expression of RNA-editing enzymes, ADAR1 and ADAR2, by 5-aza-2'-deoxycytidine and trichostatin A in human neuronal SH-SY5Y cells.
26252972 2015 Effect of mismatch on binding of ADAR2/GluR-2 pre-mRNA complex.
25873329 2015 Aberrant alternative splicing pattern of ADAR2 downregulates adenosine-to-inosine editing in glioma.
25732952 2015 Joint effect of ADARB1 gene, HTR2C gene and stressful life events on suicide attempt risk in patients with major psychiatric disorders.
25692240 2014 Positive correlation between ADAR expression and its targets suggests a complex regulation mediated by RNA editing in the human brain.
25673044 2015 Overexpression of adenosine deaminase acting on RNA 1 in chordoma tissues is associated with chordoma pathogenesis by reducing miR?125a and miR?10a expression.
25582055 2015 Modulation of microRNA editing, expression and processing by ADAR2 deaminase in glioblastoma.
25564529 2015 Recognition of duplex RNA by the deaminase domain of the RNA editing enzyme ADAR2.