Property Summary

NCBI Gene PubMed Count 65
PubMed Score 118.03
PubTator Score 226.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute quadriplegic myopathy 1.263 4.2e-04
adult high grade glioma -2.600 2.2e-08
Amyotrophic lateral sclerosis 1.084 9.0e-06
astrocytic glioma -2.100 2.7e-03
Astrocytoma, Pilocytic -1.400 1.3e-06
atypical teratoid / rhabdoid tumor -2.800 5.2e-10
cystic fibrosis 1.100 8.0e-04
dermatomyositis 1.300 1.4e-02
ependymoma -1.300 1.3e-05
glioblastoma -2.200 2.6e-10
group 4 medulloblastoma -1.100 4.3e-03
juvenile dermatomyositis -1.060 5.8e-09
lung adenocarcinoma -1.200 5.9e-14
lung cancer -1.200 1.9e-03
lung carcinoma -1.800 3.2e-17
medulloblastoma, large-cell -1.200 8.6e-04
non-small cell lung cancer -2.402 3.0e-23
oligodendroglioma -1.200 1.1e-12
osteosarcoma -1.647 1.2e-02
ovarian cancer -1.400 8.4e-07
primitive neuroectodermal tumor -1.900 2.5e-05
tuberculosis 1.600 5.6e-07
Waldenstrons macroglobulinemia -2.593 1.6e-05

Gene RIF (49)

AA Sequence

MDIEDEENMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRPLEEGSNGHSKYRLKKR      1 - 70
RKTPGPVLPKNALMQLNEIKPGLQYTLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALR     71 - 140
SFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSA    141 - 210
SPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRN    211 - 280
KKLAKARAAQSALAAIFNLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRK    281 - 350
VLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLRFLYTQLELYLNNKDD    351 - 420
QKRSIFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHEPILEGSRSYTQAGVQWCNHGSLQPRPPGL    421 - 490
LSDPSTSTFQGAGTTEPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQGERLLTMSCSDKI    491 - 560
ARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLYTLNKPLLSGISNAEAR    561 - 630
QPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHE    631 - 700
SKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLTP                                 701 - 741
//

Text Mined References (78)

PMID Year Title