Property Summary

NCBI Gene PubMed Count 96
PubMed Score 1840.08
PubTator Score 238.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
psoriasis 6694 7.2e-52
lung carcinoma 2843 2.3e-10
chronic lymphosyte leukemia 204 7.7e-05
ependymoma 4679 4.9e-04
Astrocytoma, Pilocytic 3081 5.2e-03
glioblastoma 5792 5.3e-03
adult high grade glioma 3801 1.3e-02
osteosarcoma 7950 3.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Hemolytic anemia 77 0.0 1.2
Tic disorder 8 0.0 0.9

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.300 1.3e-02
Astrocytoma, Pilocytic 1.200 5.2e-03
chronic lymphosyte leukemia 1.600 7.7e-05
ependymoma 1.500 4.9e-04
glioblastoma 1.100 5.3e-03
lung carcinoma -1.400 2.3e-10
osteosarcoma 1.806 3.6e-02
psoriasis 1.500 7.2e-52

Protein-protein Interaction (1)

Gene RIF (50)

AA Sequence

MEAETGSSVETGKKANRGTRIALVVFVGGTLVLGTILFLVSQGLLSLQAKQEYCLKPECIEAAAAILSKV      1 - 70
NLSVDPCDNFFRFACDGWISNNPIPEDMPSYGVYPWLRHNVDLKLKELLEKSISRRRDTEAIQKAKILYS     71 - 140
SCMNEKAIEKADAKPLLHILRHSPFRWPVLESNIGPEGVWSERKFSLLQTLATFRGQYSNSVFIRLYVSP    141 - 210
DDKASNEHILKLDQATLSLAVREDYLDNSTEAKSYRDALYKFMVDTAVLLGANSSRAEHDMKSVLRLEIK    211 - 280
IAEIMIPHENRTSEAMYNKMNISELSAMIPQFDWLGYIKKVIDTRLYPHLKDISPSENVVVRVPQYFKDL    281 - 350
FRILGSERKKTIANYLVWRMVYSRIPNLSRRFQYRWLEFSRVIQGTTTLLPQWDKCVNFIESALPYVVGK    351 - 420
MFVDVYFQEDKKEMMEELVEGVRWAFIDMLEKENEWMDAGTKRKAKEKARAVLAKVGYPEFIMNDTHVNE    421 - 490
DLKAIKFSEADYFGNVLQTRKYLAQSDFFWLRKAVPKTEWFTNPTTVNAFYSASTNQIRFPAGELQKPFF    491 - 560
WGTEYPRSLSYGAIGVIVGHEFTHGFDNNGRKYDKNGNLDPWWSTESEEKFKEKTKCMINQYSNYYWKKA    561 - 630
GLNVKGKRTLGENIADNGGLREAFRAYRKWINDRRQGLEEPLLPGITFTNNQLFFLSYAHVRCNSYRPEA    631 - 700
AREQVQIGAHSPPQFRVNGAISNFEEFQKAFNCPPNSTMNRGMDSCRLW                         701 - 749
//

Text Mined References (95)

PMID Year Title