Property Summary

NCBI Gene PubMed Count 45
PubMed Score 22.96
PubTator Score 20.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
inflammatory breast cancer -1.200 2.8e-03
malignant mesothelioma -1.700 2.5e-07
pancreatic ductal adenocarcinoma liver m... -1.498 1.2e-03
psoriasis 1.300 1.5e-04
tuberculosis -1.500 2.3e-05

Gene RIF (14)

AA Sequence

MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFD      1 - 70
TFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGL     71 - 140
SQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE               141 - 199
//

Text Mined References (47)

PMID Year Title