Property Summary

NCBI Gene PubMed Count 40
Grant Count 48
R01 Count 23
Funding $5,033,463.5
PubMed Score 21.93
PubTator Score 20.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Gene RIF (11)

PMID Text
24958727 define a novel function for CRADD in endothelial cells as an inducible suppressor of BCL10, a key mediator of responses to proinflammatory agonists
22279524 Study identified sequence variants in the known disease-causing genes SLC6A3 and FLVCR1, and present evidence to strongly support the pathogenicity of variants identified in TUBGCP6, BRAT1, SNIP1, CRADD, and HARS.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)
20406701 point mutations on RAIDD (R147E) and on PIDD (Y814A) exert a dominant negative effect on the formation of the PIDDosome, and that this effect cannot be applied after the PIDDosome has been formed
20237496 Observational study of gene-disease association. (HuGE Navigator)
20208132 The expressions of PIDD and RAIDD are upregulated during tumour progression in renal cell carcinomas.
19582216 Crystals are trigonal and belong to space group P3(1)21 (or its enantiomorph P3(2)21) with unit-cell parameters a = 56.3, b = 56.3, c = 64.9 A and gamma = 120 degrees .
19125251 impaired expression of RAIDD in drug induced apoptosis may play a role in the multidrug resistance of osteosarcoma cells
17329820 PIDD death domain (DD) and RAIDD DD assemble into an oligomeric complex. Within the PIDDosome, the interaction between PIDD and RAIDD is mediated by a homotypic interaction between their death domains.
More...

AA Sequence

MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFD      1 - 70
TFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGL     71 - 140
SQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE               141 - 199
//

Text Mined References (42)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25936804 2015 An Inhibitor of PIDDosome Formation.
25416956 2014 A proteome-scale map of the human interactome network.
24958727 2014 The adaptor CRADD/RAIDD controls activation of endothelial cells by proinflammatory stimuli.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
22279524 2012 Genetic mapping and exome sequencing identify variants associated with five novel diseases.
21726810 2011 Caspase-2-mediated cleavage of Mdm2 creates a p53-induced positive feedback loop.
21242994 2011 LBH589, a deacetylase inhibitor, induces apoptosis in adult T-cell leukemia/lymphoma cells via activation of a novel RAIDD-caspase-2 pathway.
20935634 2010 The Fas-FADD death domain complex structure reveals the basis of DISC assembly and disease mutations.
More...