Property Summary

NCBI Gene PubMed Count 175
Grant Count 168
R01 Count 79
Funding $24,539,526.77
PubMed Score 1140.07
PubTator Score 375.79

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P78556 Q53S51 Q99664
Symbols CKb4
LARC
ST38
MIP3A
Exodus
MIP-3a
SCYA20
MIP-3-alpha

Gene

PDB

1M8A   2HCI   2JYO  

Gene RIF (151)

PMID Text
26634210 Both MIP-3alpha and cystatin A overexpressions in NPC tumor tissues were strong independent factors of poor prognosis in NPC patients.
26536229 High CCL20 expression is associated with Inflammatory Bowel Disease.
26448160 human lung epithelial cells secrete CCL20 and BD2 in response to B. abortus and/or to cytokines produced by infected monocytes.
26400278 High-risk HPV-type lesions might inhibit the chemokine CCL20 on Langerhans cells through E6 and E7 to escape the immune response.
26345847 Tregs of unexplained recurrent miscarriage patients was significantly lower than that in controls. CCL20-CCR6 could drive immune activity of CD4(+)FOXP3(+) Tregs, followed by their migration to the feto-maternal microenvironment
26296735 ADAM10 activity contributes to house dust mite-induced shedding of chemokines, including CCL20
26284335 CCL4 and CCL20 recruit functionally different T lymphocyte subsets into oesophageal carcinoma.
26156805 AEG-1 mediates CCL20/CCR6-induced EMT development via both Erk1/2 and Akt signaling pathway in cervical cancer, which indicates that CCL20/CCR6-AEG-1-EMT pathway could be suggested as a useful target to affect the progression of cervical cancer.
26125463 stimulates leukocyte migration in ovary, may aid in final ovulatory events
26116899 HIV-1 Vpr downregulates the expression of CCL20 in human monocyte-derived dendritic cells
More...

AA Sequence

MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKK      1 - 70
LSVCANPKQTWVKYIVRLLSKKVKNM                                                 71 - 96
//

Text Mined References (176)

PMID Year Title
26634210 2015 Expression and Prognostic Significance of Macrophage Inflammatory Protein-3 Alpha and Cystatin A in Nasopharyngeal Carcinoma.
26536229 2015 Expression of CCL20 and Its Corresponding Receptor CCR6 Is Enhanced in Active Inflammatory Bowel Disease, and TLR3 Mediates CCL20 Expression in Colonic Epithelial Cells.
26448160 2015 CCL20 and Beta-Defensin 2 Production by Human Lung Epithelial Cells and Macrophages in Response to Brucella abortus Infection.
26400278 2015 Correlation of E6 and E7 levels in high-risk HPV16 type cervical lesions with CCL20 and Langerhans cells.
26345847 2015 Regulation of CD4?FOXP3? T cells by CCL20/CCR6 axis in early unexplained recurrent miscarriage patients.
26296735 2015 ADAM10 mediates the house dust mite-induced release of chemokine ligand CCL20 by airway epithelium.
26284335 2015 CTL- vs Treg lymphocyte-attracting chemokines, CCL4 and CCL20, are strong reciprocal predictive markers for survival of patients with oesophageal squamous cell carcinoma.
26156805 2015 The key role of astrocyte elevated gene-1 in CCR6-induced EMT in cervical cancer.
26125463 2015 Chemokine Ligand 20: A Signal for Leukocyte Recruitment During Human Ovulation?
26103626 2015 CXCL8 and CCL20 Enhance Osteoclastogenesis via Modulation of Cytokine Production by Human Primary Osteoblasts.
More...