Property Summary

NCBI Gene PubMed Count 195
PubMed Score 1250.33
PubTator Score 375.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (25)

Disease log2 FC p
psoriasis 3.200 1.8e-06
active Crohn's disease 3.398 2.1e-02
active ulcerative colitis 3.988 9.7e-03
Barrett's esophagus 2.000 2.8e-02
Bipolar Disorder 3.404 4.6e-02
cutaneous lupus erythematosus 2.100 1.6e-02
cystic fibrosis 1.078 3.3e-02
ependymoma 1.400 7.3e-03
esophageal adenocarcinoma 2.600 2.0e-02
glioblastoma 1.200 2.0e-02
head and neck cancer 3.900 7.0e-09
interstitial cystitis 2.000 4.2e-02
intraductal papillary-mucinous carcinoma... 2.800 2.5e-02
intraductal papillary-mucinous neoplasm ... 4.700 3.4e-04
lung adenocarcinoma 1.100 1.9e-02
lung cancer -2.600 3.2e-05
lung carcinoma -1.700 2.0e-03
malignant mesothelioma -5.700 6.1e-09
non-small cell lung cancer 1.700 6.0e-03
ovarian cancer 1.900 1.6e-04
pancreatic cancer 2.600 1.3e-05
pediatric high grade glioma 1.200 8.9e-03
primary Sjogren syndrome 1.500 9.6e-04
tuberculosis -7.400 2.3e-09
urothelial carcinoma -4.000 5.0e-05

Gene RIF (172)

AA Sequence

MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKK      1 - 70
LSVCANPKQTWVKYIVRLLSKKVKNM                                                 71 - 96
//

Text Mined References (196)

PMID Year Title