Property Summary

NCBI Gene PubMed Count 49
Grant Count 36
R01 Count 28
Funding $2,804,976.74
PubMed Score 23.48
PubTator Score 55.52

Knowledge Summary

Patent

No data available

Expression

Gene RIF (39)

PMID Text
26187331 review of IL-4 and IL-13 receptor structure, receptor regulation, signaling and experimental therapeutics [review]
26153764 IL-13Ralpha1 has a protective role in bleomycin-induced pulmonary injury and repair.
26088753 analysis of IL-4 and IL-13 receptors in cancer biology and discussion of pre-clinical and clinical studies pertaining to recombinant immunotoxins designed to target these receptors [review]
25896327 Results identified FAM120A in the IL13/IL13Ralpha2 signaling pathway as a key mediator of invasion and liver metastasis in colon cancer.
25766112 required for induction of the alternative macrophage activation pathway by IL-13 but not by IL-4
25529447 miR-143 regulation of IL-13-induced inflammatory cytokine and mucus production in nasal epithelial cells from allergic rhinitis patients probably partly depends on inhibition of IL13Ralpha1.
25483786 Data show that high expression of interleukin-4 receptor IL-4Ralpha correlated with increased recurrence, while interleukin-13 receptor IL-13Ralpha1 had an inverse relationship to recurrence and survival in oral cavity squamous cell carcinoma patients.
23965966 MiR-143 may be associated with allergic reaction in human mast cells via downregulation of IL13RA1.
23169588 In humans, IL-13Ralpha1 lies within the PARK12 locus of susceptibility to Parkinson's disease and may have a role in the pathogenesis of this neurodegenerative disease.
22441356 Expression of IL-4, IL-4R, and IL-13R are involved in the process of local metastases in colorectal cancer, while IL-13 expression has an impact on survival.
More...

AA Sequence

MEWPARLCGLWALLLCAGGGGGGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHF      1 - 70
GDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPPEGDPESAVTELQCIWHNLS     71 - 140
YMKCSWLPGRNTSPDTNYTLYYWHRSLEKIHQCENIFREGQYFGCSFDLTKVKDSSFEQHSVQIMVKDNA    141 - 210
GKIKPSFNIVPLTSRVKPDPPHIKNLSFHNDDLYVQWENPQNFISRCLFYEVEVNNSQTETHNVFYVQEA    211 - 280
KCENPEFERNVENTSCFMVPGVLPDTLNTVRIRVKTNKLCYEDDKLWSNWSQEMSIGKKRNSTLYITMLL    281 - 350
IVPVIVAGAIIVLLLYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQTKEETDSVVLIE    351 - 420
NLKKASQ                                                                   421 - 427
//

Text Mined References (52)

PMID Year Title
26187331 2015 Commentary: IL-4 and IL-13 receptors and signaling.
26153764 2016 A protective role for IL-13 receptor ? 1 in bleomycin-induced pulmonary injury and repair.
26088753 2015 Targeting of IL-4 and IL-13 receptors for cancer therapy.
25896327 2015 IL13 Receptor ?2 Signaling Requires a Scaffold Protein, FAM120A, to Activate the FAK and PI3K Pathways in Colon Cancer Metastasis.
25766112 2015 The Interleukin-13 Receptor-?1 Chain Is Essential for Induction of the Alternative Macrophage Activation Pathway by IL-13 but Not IL-4.
25529447 2015 miR-143 inhibits interleukin-13-induced inflammatory cytokine and mucus production in nasal epithelial cells from allergic rhinitis patients by targeting IL13R?1.
25483786 2015 Recurrence and cancer-specific survival according to the expression of IL-4R? and IL-13R?1 in patients with oral cavity cancer.
23965966 2013 MicroRNA-143 downregulates interleukin-13 receptor alpha1 in human mast cells.
23169588 2012 Cutting edge: IL-13R?1 expression in dopaminergic neurons contributes to their oxidative stress-mediated loss following chronic peripheral treatment with lipopolysaccharide.
22441356 2012 Expression of interleukin-4 and interleukin-13 and their receptors in colorectal cancer.
More...