Property Summary

NCBI Gene PubMed Count 52
PubMed Score 22.99
PubTator Score 55.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma 1.100 4.4e-03
astrocytoma 2.000 2.8e-02
Astrocytoma, Pilocytic 1.800 2.3e-09
atypical teratoid / rhabdoid tumor 1.300 8.4e-03
Breast cancer 2.200 3.2e-02
Chronic Lymphocytic Leukemia -2.145 3.0e-05
ependymoma 1.600 8.3e-08
esophageal adenocarcinoma -1.400 3.2e-02
gastric cancer -1.200 1.4e-02
glioblastoma 1.500 1.3e-05
group 4 medulloblastoma -1.200 3.9e-04
intraductal papillary-mucinous adenoma (... 1.200 3.8e-02
intraductal papillary-mucinous carcinoma... 1.300 4.1e-02
intraductal papillary-mucinous neoplasm ... 1.500 3.0e-02
lung adenocarcinoma 1.368 3.6e-05
lung cancer -1.600 2.9e-04
medulloblastoma, large-cell -1.900 3.6e-03
osteosarcoma 2.790 7.9e-05
ovarian cancer -1.900 1.4e-05
pancreatic ductal adenocarcinoma liver m... -1.614 2.5e-02
psoriasis 1.100 2.5e-05
subependymal giant cell astrocytoma 1.968 1.1e-02
Waldenstrons macroglobulinemia -2.383 3.2e-05

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (41)

AA Sequence

MEWPARLCGLWALLLCAGGGGGGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHF      1 - 70
GDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPPEGDPESAVTELQCIWHNLS     71 - 140
YMKCSWLPGRNTSPDTNYTLYYWHRSLEKIHQCENIFREGQYFGCSFDLTKVKDSSFEQHSVQIMVKDNA    141 - 210
GKIKPSFNIVPLTSRVKPDPPHIKNLSFHNDDLYVQWENPQNFISRCLFYEVEVNNSQTETHNVFYVQEA    211 - 280
KCENPEFERNVENTSCFMVPGVLPDTLNTVRIRVKTNKLCYEDDKLWSNWSQEMSIGKKRNSTLYITMLL    281 - 350
IVPVIVAGAIIVLLLYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQTKEETDSVVLIE    351 - 420
NLKKASQ                                                                   421 - 427
//

Text Mined References (55)

PMID Year Title