Property Summary

NCBI Gene PubMed Count 49
Grant Count 136
R01 Count 82
Funding $21,120,676.16
PubMed Score 243.12
PubTator Score 187.39

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P78545 B2R5Q6 Q6IAP8 Q7RU03 Q7Z3X2 Q8NFG2 Q99718
Symbols ERT
ESX
EPR-1
ESE-1

Gene

PANTHER Protein Class (1)

PDB

2E8P  

 GO Component (2)

Gene RIF (32)

PMID Text
26920025 ELF3 is a novel transcriptional repressor of estrogen receptor alpha in breast cancer cells.
26804919 ELF3 is a frequently mutated tumor suppressor gene of periampullary tumors.
26185364 suggest that ESE-1 may play a role in regulating airway inflammation by regulating ICAM-1 expression
25926267 our data suggested that ESE1/ELF3 may promote the UC progression via accelerating NF-kappaB activation and thus facilitating IEC apoptosis.
24971534 ESE-1 actS as an upstream effector to regulate OCT4 transcription in NCCIT pluripotent embryonic carcinoma cells.
24874735 data identify Elf3 as a pivotal driver for beta-catenin signaling in CRC, and highlight potential prognostic and therapeutic significance of Elf3 in CRC.
24694612 data suggest that polyomavirus enhancer activator 3 and epithelium-specific transcription factor-1 may play important roles in pluri potent and tumorigenic embryonic carcinoma cells.
24374157 ELF3 is a candidate transcriptional regulator involved in human urothelial cytodifferentiation.
23867815 HIV-1 gp120-treated vaginal epithelial cells show upregulation of E74-like factor 3 (ELF3) expression as compared to untreated control
23687337 The concordant upregulation of ESE1/ELF3 and NF-kappaB in human prostate tumors.
More...

AA Sequence

MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKT      1 - 70
QVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWII     71 - 140
ELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSS    141 - 210
DSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIR    211 - 280
DILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRL    281 - 350
VYKFGKNSSGWKEEEVLQSRN                                                     351 - 371
//

Text Mined References (61)

PMID Year Title
26977885 2016 Protein Kinase C? Drives a NOTCH3-dependent Stem-like Phenotype in Mutant KRAS Lung Adenocarcinoma.
26920025 2016 A transcriptional repressive role for epithelial-specific ETS factor ELF3 on oestrogen receptor alpha in breast cancer cells.
26804919 2016 Ampullary Cancers Harbor ELF3 Tumor Suppressor Gene Mutations and Exhibit Frequent WNT Dysregulation.
26185364 2015 Epithelium-Specific Ets-Like Transcription Factor 1, ESE-1, Regulates ICAM-1 Expression in Cultured Lung Epithelial Cell Lines.
25926267 2015 Epithelial-specific ETS-1 (ESE1/ELF3) regulates apoptosis of intestinal epithelial cells in ulcerative colitis via accelerating NF-?B activation.
24971534 2014 Transcriptional regulation of OCT4 by the ETS transcription factor ESE-1 in NCCIT human embryonic carcinoma cells.
24874735 2014 Elf3 drives ?-catenin transactivation and associates with poor prognosis in colorectal cancer.
24694612 2014 Differential expression of ETS family transcription factors in NCCIT human embryonic carcinoma cells upon retinoic acid-induced differentiation.
24374157 2014 Identification of ELF3 as an early transcriptional regulator of human urothelium.
23687337 2013 ETS transcription factor ESE1/ELF3 orchestrates a positive feedback loop that constitutively activates NF-?B and drives prostate cancer progression.
More...