Property Summary

NCBI Gene PubMed Count 91
PubMed Score 142.74
PubTator Score 149.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
acute myeloid leukemia 1.300 3.5e-02
adrenocortical carcinoma -1.020 3.9e-04
astrocytoma 2.400 1.8e-03
atypical teratoid / rhabdoid tumor 1.300 3.6e-05
Chronic Lymphocytic Leukemia 1.140 2.2e-02
chronic rhinosinusitis -1.802 7.8e-03
colon cancer -1.200 9.9e-04
ependymoma 1.100 2.9e-02
gastric cancer -1.300 4.3e-04
glioblastoma 1.800 1.8e-02
group 4 medulloblastoma -1.300 3.9e-03
inflammatory breast cancer -2.300 7.8e-04
intraductal papillary-mucinous adenoma (... -1.200 2.1e-02
intraductal papillary-mucinous carcinoma... -1.400 1.0e-02
intraductal papillary-mucinous neoplasm ... -1.900 1.1e-02
lung adenocarcinoma -1.400 5.8e-06
lung cancer -1.300 6.4e-03
malignant mesothelioma -2.700 1.3e-07
non-small cell lung cancer -1.560 2.0e-17
osteosarcoma -1.793 4.7e-02
ovarian cancer 1.200 1.3e-02
pancreatic cancer -1.100 4.1e-04
periodontitis 1.300 2.2e-33
pituitary cancer -1.800 1.4e-05
primary pancreatic ductal adenocarcinoma -2.077 3.2e-03
psoriasis -1.100 1.5e-07
pterygium -1.300 3.5e-02
ulcerative colitis 1.100 1.5e-02

Gene RIF (67)

AA Sequence

MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRI      1 - 70
NHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQ     71 - 140
VLLGRSSPSKNYVMAVSS                                                        141 - 158
//

Text Mined References (91)

PMID Year Title