Property Summary

NCBI Gene PubMed Count 85
Grant Count 19
R01 Count 8
Funding $5,523,503.66
PubMed Score 132.80
PubTator Score 149.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
gastric cancer -1.300 0.000
Chronic Lymphocytic Leukemia 1.140 0.022
malignant mesothelioma -2.700 0.000
ependymoma 1.100 0.029
osteosarcoma -1.793 0.047
astrocytoma 2.400 0.002
glioblastoma 1.800 0.018
periodontitis 1.300 0.000
atypical teratoid / rhabdoid tumor 1.300 0.000
adrenocortical carcinoma -1.982 0.000
primary pancreatic ductal adenocarcinoma -2.077 0.003
non-small cell lung cancer -1.560 0.000
intraductal papillary-mucinous adenoma (... -1.600 0.012
intraductal papillary-mucinous carcinoma... -1.900 0.011
intraductal papillary-mucinous neoplasm ... -2.600 0.007
lung cancer -2.800 0.000
colon cancer -2.800 0.004
pancreatic cancer -1.700 0.008
group 4 medulloblastoma -1.300 0.004
lung adenocarcinoma -1.400 0.000
psoriasis -1.300 0.000
inflammatory breast cancer -2.300 0.001
pterygium -1.300 0.035
acute myeloid leukemia 1.800 0.048
ulcerative colitis 1.100 0.015
ovarian cancer 1.200 0.013
pituitary cancer -2.900 0.000
chronic rhinosinusitis -1.802 0.008

Gene RIF (61)

PMID Text
26912148 BTG2 stimulates mRNA deadenylation via CAF1 activation through interaction with PABPC1. Interaction of BTG2 with the first RRM domain of PABPC1 is required for BTG2 to control cell proliferation.
26818199 clinical data support conclusions generated from patient-derived xenograft models and indicate that BTG2 expression is a candidate prognostic biomarker for TNBC.
26722427 Overexpression of BTG2 inhibited the proliferation and migration/invasion of human osteosarcoma cells in vitro
26394836 SETD1A suppresses BTG2 expression through its induction of several BTG2-targeting miRNAs.
26151427 miR-21 was found to be overexpressed and BTG2 was found to to be downregulated in HepG2 liver cancer cells.
25626081 Results indicate that miR27a and BTG2 promote the migration and the growth of glioblastoma (GBM) cells and miR27a directly targets BTG2 in GBM cells.
25576360 By applying loss-and-gain function analysis in NSCLC cell lines, we demonstrated that miR-25-BTG2 axis could directly regulated BTG2 expression and affect radiotherapy sensitivity of NSCLC cells.
25405282 In this review, we summarize the latest findings in BTG2 studies, highlighting the mechanisms for the regulatory effects of microRNAs (miRNAs) on BTG2 gene expression in the most common human cancers.
25284287 BTG2 expression was inversely correlated with increased expression of the DNA methyltransferases DNMT1 and DNMT3a in MIBC, but not NMIBC, suggesting a potential role for BTG2 expression in muscle invasion of bladder cancer
24981574 Our results indicated that cisplatin attenuates prostate cancer cell proliferation partly mediated by upregulation of BTG2 through the p53-dependent pathway or p53-independent NFkappaB pathway.
More...

AA Sequence

MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRI      1 - 70
NHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQ     71 - 140
VLLGRSSPSKNYVMAVSS                                                        141 - 158
//

Text Mined References (85)

PMID Year Title
26912148 2016 BTG2 bridges PABPC1 RNA-binding domains and CAF1 deadenylase to control cell proliferation.
26818199 2016 p53 deficiency linked to B cell translocation gene 2 (BTG2) loss enhances metastatic potential by promoting tumor growth in primary and metastatic sites in patient-derived xenograft (PDX) models of triple-negative breast cancer.
26722427 2015 BTG2 inhibits the proliferation and metastasis of osteosarcoma cells by suppressing the PI3K/AKT pathway.
26394836 2015 SETD1A modulates cell cycle progression through a miRNA network that regulates p53 target genes.
26151427 2015 MicroRNA?21 regulates the expression of BTG2 in HepG2 liver cancer cells.
25626081 2015 miR?27a suppresses the clonogenic growth and migration of human glioblastoma multiforme cells by targeting BTG2.
25576360 2015 miR-25 modulates NSCLC cell radio-sensitivity through directly inhibiting BTG2 expression.
25416956 2014 A proteome-scale map of the human interactome network.
25405282 2015 BTG2: a rising star of tumor suppressors (review).
25284287 2014 Inhibition of bladder cancer invasion by Sp1-mediated BTG2 expression via inhibition of DNA methyltransferase 1.
More...