Property Summary

NCBI Gene PubMed Count 60
Grant Count 41
R01 Count 32
Funding $3,812,699.68
PubMed Score 261.57
PubTator Score 159.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
nephrosclerosis -1.514 0.042
pancreatic cancer 1.200 0.000
astrocytic glioma -1.900 0.020
posterior fossa group B ependymoma -2.400 0.000
oligodendroglioma -2.100 0.015
esophageal adenocarcinoma -1.500 0.031
psoriasis 1.300 0.000
osteosarcoma -1.770 0.035
glioblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -1.400 0.013
medulloblastoma -1.200 0.010
medulloblastoma, large-cell -2.000 0.003
hereditary spastic paraplegia 1.286 0.018
juvenile dermatomyositis 2.370 0.000
tuberculosis and treatment for 6 months -1.100 0.004
non-small cell lung cancer 1.452 0.000
lung cancer 1.600 0.014
active Crohn's disease 1.278 0.029
interstitial cystitis -1.800 0.000
pediatric high grade glioma -1.700 0.000
pancreatic carcinoma 1.200 0.000
lung adenocarcinoma 1.159 0.019
Endometriosis -2.175 0.012
lung carcinoma 2.000 0.000
pituitary cancer -1.900 0.000

Gene RIF (56)

PMID Text
26537638 circulating Arginase 2 concentrations increase in clinical erectile dysfunction (ED) and are associated with increased risk for ED
26116899 HIV-1 Vpr downregulates the expression of ARG2 in human monocyte-derived dendritic cells
26054597 High arginase II expression correlates with poor survival for patients with neuroblastoma. Neuroblastoma suppresses T-cell proliferation via arginase II expression and activity.
25635535 Arg-II, p38, and S6K1 form a positive circuit which regulates endothelial senescence and cardiovascular aging.
25484082 arginase 2 impairs endothelial autophagy independently of the L-arginine ureahydrolase activity through activation of RPS6KB1 and inhibition of PRKAA, which is implicated in atherogenesis
25205225 Arg1 expression is decreased, and Arg2 expression is increased in the newborn congenital obstructive nephropathy and in the mouse model.
25034973 high fat diet enhanced arginase-II expression/activity and p38mapk activity, which was associated with eNOS-uncoupling as revealed by decreased nitric oxide
24903103 OxLDL triggers retrograde translocation of arginase2 in aortic endothelial cells via ROCK and mitochondrial processing peptidase.
24879052 study identified arginase II as a new target of miR-17-5p in human pulmonary artery smooth muscle cells (hPASMC), with miR-17-5p involved in the hypoxic induction of arginase II in hPASMC; also found evidence supporting a feedback loop between arginase II and miR-17-5p, such that arginase II regulates miR-17-5p expression in hPASMC
24860943 These results demonstrate that S6K1 and arginase-II form a positive circuit mediating the detrimental effects of chronic L-arginine supplementation on endothelial cells.
More...

AA Sequence

MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGD      1 - 70
LSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVV     71 - 140
WVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILK    141 - 210
NYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIA    211 - 280
EEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQA    281 - 350
RVRI                                                                      351 - 354
//

Text Mined References (62)

PMID Year Title
26054597 2015 Neuroblastoma Arginase Activity Creates an Immunosuppressive Microenvironment That Impairs Autologous and Engineered Immunity.
25635535 2015 Role of p38 mitogen-activated protein kinase in vascular endothelial aging: interaction with Arginase-II and S6K1 signaling pathway.
25484082 2014 ARG2 impairs endothelial autophagy through regulation of MTOR and PRKAA/AMPK signaling in advanced atherosclerosis.
25205225 2014 Label-free quantitative urinary proteomics identifies the arginase pathway as a new player in congenital obstructive nephropathy.
25034973 2014 p38 mitogen-activated protein kinase is involved in arginase-II-mediated eNOS-uncoupling in obesity.
24903103 2014 OxLDL triggers retrograde translocation of arginase2 in aortic endothelial cells via ROCK and mitochondrial processing peptidase.
24879052 2014 Arginase II is a target of miR-17-5p and regulates miR-17-5p expression in human pulmonary artery smooth muscle cells.
24860943 2014 Long term exposure to L-arginine accelerates endothelial cell senescence through arginase-II and S6K1 signaling.
24833798 2014 Transcriptional regulation of endothelial arginase 2 by histone deacetylase 2.
24442486 2014 Human cytomegalovirus induces upregulation of arginase II: possible implications for vasculopathies.
More...