Property Summary

NCBI Gene PubMed Count 60
PubMed Score 261.57
PubTator Score 159.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 2.39382311508164E-21
lung carcinoma 2844 6.79697457630509E-17
posterior fossa group B ependymoma 1530 2.15500980841802E-8
non-small cell lung cancer 2798 6.51104025926753E-8
juvenile dermatomyositis 1189 4.220649313612E-7
pituitary cancer 1972 6.02949729915026E-5
pediatric high grade glioma 2712 1.35432110725516E-4
glioblastoma 5572 1.74867300058799E-4
interstitial cystitis 2299 2.06409027968512E-4
pancreatic cancer 2300 3.96503878109757E-4
pancreatic carcinoma 567 3.96503878109758E-4
medulloblastoma, large-cell 6234 0.00258816578561244
tuberculosis and treatment for 6 months 686 0.00361487227481102
medulloblastoma 1524 0.0104525604480708
Endometriosis 535 0.0120848772050226
atypical teratoid / rhabdoid tumor 4369 0.0126301478897084
lung cancer 4473 0.0138998553196487
oligodendroglioma 2849 0.0147104453932554
hereditary spastic paraplegia 313 0.0178760283737765
lung adenocarcinoma 2714 0.0190410607448426
astrocytic glioma 2241 0.0201286856838895
active Crohn's disease 918 0.0294934996476735
esophageal adenocarcinoma 737 0.0313754966175192
osteosarcoma 7933 0.0351041087704816
nephrosclerosis 329 0.0420208654098984

Expression

  Differential Expression (25)

Disease log2 FC p
nephrosclerosis -1.514 0.042
pancreatic cancer 1.200 0.000
astrocytic glioma -1.900 0.020
posterior fossa group B ependymoma -2.400 0.000
oligodendroglioma -2.100 0.015
esophageal adenocarcinoma -1.500 0.031
psoriasis 1.300 0.000
osteosarcoma -1.770 0.035
glioblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -1.400 0.013
medulloblastoma -1.200 0.010
medulloblastoma, large-cell -2.000 0.003
hereditary spastic paraplegia 1.286 0.018
juvenile dermatomyositis 2.370 0.000
tuberculosis and treatment for 6 months -1.100 0.004
non-small cell lung cancer 1.452 0.000
lung cancer 1.600 0.014
active Crohn's disease 1.278 0.029
interstitial cystitis -1.800 0.000
pediatric high grade glioma -1.700 0.000
pancreatic carcinoma 1.200 0.000
lung adenocarcinoma 1.159 0.019
Endometriosis -2.175 0.012
lung carcinoma 2.000 0.000
pituitary cancer -1.900 0.000

Synonym

Accession P78540 B2R690 Q6FHY8
Symbols

Gene

PANTHER Protein Class (1)

PDB

1PQ3   4HZE   4I06   4IE2   4IE3   4IXU   4IXV  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (56)

PMID Text
26537638 circulating Arginase 2 concentrations increase in clinical erectile dysfunction (ED) and are associated with increased risk for ED
26116899 HIV-1 Vpr downregulates the expression of ARG2 in human monocyte-derived dendritic cells
26054597 High arginase II expression correlates with poor survival for patients with neuroblastoma. Neuroblastoma suppresses T-cell proliferation via arginase II expression and activity.
25635535 Arg-II, p38, and S6K1 form a positive circuit which regulates endothelial senescence and cardiovascular aging.
25484082 arginase 2 impairs endothelial autophagy independently of the L-arginine ureahydrolase activity through activation of RPS6KB1 and inhibition of PRKAA, which is implicated in atherogenesis
25205225 Arg1 expression is decreased, and Arg2 expression is increased in the newborn congenital obstructive nephropathy and in the mouse model.
25034973 high fat diet enhanced arginase-II expression/activity and p38mapk activity, which was associated with eNOS-uncoupling as revealed by decreased nitric oxide
24903103 OxLDL triggers retrograde translocation of arginase2 in aortic endothelial cells via ROCK and mitochondrial processing peptidase.
24879052 study identified arginase II as a new target of miR-17-5p in human pulmonary artery smooth muscle cells (hPASMC), with miR-17-5p involved in the hypoxic induction of arginase II in hPASMC; also found evidence supporting a feedback loop between arginase II and miR-17-5p, such that arginase II regulates miR-17-5p expression in hPASMC
24860943 These results demonstrate that S6K1 and arginase-II form a positive circuit mediating the detrimental effects of chronic L-arginine supplementation on endothelial cells.
More...

AA Sequence

MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGD      1 - 70
LSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVV     71 - 140
WVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILK    141 - 210
NYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIA    211 - 280
EEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQA    281 - 350
RVRI                                                                      351 - 354
//

Text Mined References (62)

PMID Year Title
26054597 2015 Neuroblastoma Arginase Activity Creates an Immunosuppressive Microenvironment That Impairs Autologous and Engineered Immunity.
25635535 2015 Role of p38 mitogen-activated protein kinase in vascular endothelial aging: interaction with Arginase-II and S6K1 signaling pathway.
25484082 2014 ARG2 impairs endothelial autophagy through regulation of MTOR and PRKAA/AMPK signaling in advanced atherosclerosis.
25205225 2014 Label-free quantitative urinary proteomics identifies the arginase pathway as a new player in congenital obstructive nephropathy.
25034973 2014 p38 mitogen-activated protein kinase is involved in arginase-II-mediated eNOS-uncoupling in obesity.
24903103 2014 OxLDL triggers retrograde translocation of arginase2 in aortic endothelial cells via ROCK and mitochondrial processing peptidase.
24879052 2014 Arginase II is a target of miR-17-5p and regulates miR-17-5p expression in human pulmonary artery smooth muscle cells.
24860943 2014 Long term exposure to L-arginine accelerates endothelial cell senescence through arginase-II and S6K1 signaling.
24833798 2014 Transcriptional regulation of endothelial arginase 2 by histone deacetylase 2.
24442486 2014 Human cytomegalovirus induces upregulation of arginase II: possible implications for vasculopathies.
More...