Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.20
PubTator Score 787.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Retinitis pigmentosa 3 16 4.858 2.4

Expression

  Differential Expression (40)

Disease log2 FC p
active ulcerative colitis 1.169 1.4e-02
acute quadriplegic myopathy 2.343 1.3e-06
adult high grade glioma 1.600 4.5e-02
astrocytic glioma 2.100 3.6e-02
Astrocytoma, Pilocytic 3.100 1.3e-06
autosomal dominant Emery-Dreifuss muscul... 1.738 7.3e-04
Becker muscular dystrophy 1.327 2.9e-03
breast carcinoma -1.600 2.6e-04
colon cancer -3.300 2.6e-07
COPD 1.400 6.2e-03
cutaneous lupus erythematosus 1.300 3.7e-02
cystic fibrosis 3.519 2.8e-08
dermatomyositis 1.700 2.2e-02
Duchenne muscular dystrophy 2.431 1.7e-10
ductal carcinoma in situ -1.700 6.2e-03
ependymoma -1.100 4.8e-02
fibroadenoma -2.100 3.6e-04
glioblastoma 1.900 1.9e-03
group 4 medulloblastoma -2.100 8.7e-03
inflammatory breast cancer -1.700 5.3e-04
interstitial cystitis -1.500 3.7e-03
intraductal papillary-mucinous adenoma (... -4.700 4.3e-05
intraductal papillary-mucinous carcinoma... -4.700 8.4e-05
intraductal papillary-mucinous neoplasm ... -4.400 1.7e-03
invasive ductal carcinoma -1.951 2.4e-04
juvenile dermatomyositis 2.290 2.2e-13
limb girdle muscular dystrophy 2A 1.766 3.4e-07
lung adenocarcinoma -1.400 4.6e-09
lung cancer -2.000 1.8e-03
lung carcinoma -2.300 6.4e-15
malignant mesothelioma -5.800 4.3e-10
nephrosclerosis 1.394 1.1e-02
non-small cell lung cancer -2.115 5.6e-13
oligodendroglioma 2.500 2.4e-02
osteosarcoma 1.917 4.7e-02
ovarian cancer -1.400 5.6e-03
pancreatic ductal adenocarcinoma liver m... -2.352 9.0e-04
pituitary cancer -2.200 2.8e-04
psoriasis 1.800 1.6e-03
spina bifida -2.580 4.5e-02

Gene RIF (8)

AA Sequence

MGSPAHRPALLLLLPPLLLLLLLRVPPSRSFPGSGDSPLEDDEVGYSHPRYKDTPWCSPIKVKYGDVYCR      1 - 70
APQGGYYKTALGTRCDIRCQKGYELHGSSLLICQSNKRWSDKVICKQKRCPTLAMPANGGFKCVDGAYFN     71 - 140
SRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPPRIKCPSVKERIAEPNKLTVRVSWETPEGRD    141 - 210
TADGILTDVILKGLPPGSNFPEGDHKIQYTVYDRAENKGTCKFRVKVRVKRCGKLNAPENGYMKCSSDGD    211 - 280
NYGATCEFSCIGGYELQGSPARVCQSNLAWSGTEPTCAAMNVNVGVRTAAALLDQFYEKRRLLIVSTPTA    281 - 350
RNLLYRLQLGMLQQAQCGLDLRHITVVELVGVFPTLIGRIGAKIMPPALALQLRLLLRIPLYSFSMVLVD    351 - 420
KHGMDKERYVSLVMPVALFNLIDTFPLRKEEMVLQAEMSQTCNT                              421 - 464
//

Text Mined References (19)

PMID Year Title