Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.23
PubTator Score 787.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
breast carcinoma 1614 2.76841721023412E-32
lung carcinoma 2844 6.41001315622375E-15
lung adenocarcinoma 2714 1.37204275875335E-13
juvenile dermatomyositis 1189 2.23322094923434E-13
non-small cell lung cancer 2798 5.64234291416927E-13
Duchenne muscular dystrophy 602 1.68039089404331E-10
malignant mesothelioma 3163 4.26513411703307E-10
cystic fibrosis 1670 2.77297565929086E-8
colon cancer 1475 2.584285575462E-7
limb girdle muscular dystrophy 2A 156 3.39021549382682E-7
acute quadriplegic myopathy 1157 1.30420499535889E-6
pilocytic astrocytoma 3086 1.60073890117003E-6
invasive ductal carcinoma 2950 2.47896026187557E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 4.30824830091169E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 8.38975190627239E-5
non-inflammatory breast cancer 208 1.23119923128862E-4
pituitary cancer 1972 2.75868715078035E-4
fibroadenoma 557 3.63499408987669E-4
ovarian cancer 8492 5.49741534404977E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 7.28656874861127E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 9.02140626932565E-4
psoriasis 6685 0.00160442844204962
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00167455840168754
lung cancer 4473 0.00176009668936686
Becker muscular dystrophy 187 0.00285643999116098
glioblastoma 5572 0.00350637965376511
interstitial cystitis 2299 0.00373655554286837
COPD 116 0.00624287374799134
ductal carcinoma in situ 1745 0.00624998349062281
group 4 medulloblastoma 1875 0.00871514723462106
pediatric high grade glioma 2712 0.00917876049351728
nephrosclerosis 329 0.0106547460554062
active ulcerative colitis 477 0.0137204451210223
astrocytoma 1493 0.0162265297964824
dermatomyositis 967 0.0218905824538888
oligodendroglioma 2849 0.0242242901608045
cutaneous lupus erythematosus 1056 0.0374357894781876
spina bifida 1064 0.0450154860830425
osteosarcoma 7933 0.0472689470075835
ependymoma 2514 0.047773977894584
Disease Target Count Z-score Confidence
Retinitis pigmentosa 156 3.576 1.8

Expression

Synonym

Accession P78539 A8K065 B3KWP8 B4DDB8 B4DQH5 F5H4D7 G3V1L0 Q4VX66 Q99652 Q99913
Symbols DRS
ETX1
SRPX1
HEL-S-83p

Gene

  Ortholog (12)

Gene RIF (8)

PMID Text
20406461 PELO is subcellularly localized at the actin cytoskeleton, interacts with HAX1, EIF3G and SRPX proteins and that this interaction occurs at the cytoskeleton; this interaction may facilitate PELO to detect and degrade aberrant mRNAs.
19862339 This is the first report demonstrating overexpression of ETX1 in glaucomatous trabecular meshwork.
19424611 Downregulation of drs tumor suppressor gene in highly malignant human pulmonary neuroendocrine tumors.
15021917 An apoptosis-inducing protein localized in the endoplasmic reticulum which increases efficiency of apoptosis
12874760 Down-regulation of drs mRNA is closely correlated with development of prostate carcinoma, suggesting a tumor-suppressor function of the drs gene in this cancer.
12716466 down-regulation of drs mRNA is closely correlated with carcinomas which arise from adenomatous polyps in the course of the adenoma-carcinoma sequence, but most carcinomas arising de novo are independent of the tumor suppressor function of the drs gene
12152160 expression of drs mRNA in well-differentiated, moderately differentiated, and poorly differentiated lung adenocarcinoma tissues (drs; down-regulated by v-scr)
209648 The SRPX protein contains the P-DUDES structural domain in its C-terminal region. This domain has significant albeit remote sequence similarity to thioredoxin-like domains, and is predicted to possess an oxidoreductase function.

AA Sequence

MGSPAHRPALLLLLPPLLLLLLLRVPPSRSFPGSGDSPLEDDEVGYSHPRYKDTPWCSPIKVKYGDVYCR      1 - 70
APQGGYYKTALGTRCDIRCQKGYELHGSSLLICQSNKRWSDKVICKQKRCPTLAMPANGGFKCVDGAYFN     71 - 140
SRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPPRIKCPSVKERIAEPNKLTVRVSWETPEGRD    141 - 210
TADGILTDVILKGLPPGSNFPEGDHKIQYTVYDRAENKGTCKFRVKVRVKRCGKLNAPENGYMKCSSDGD    211 - 280
NYGATCEFSCIGGYELQGSPARVCQSNLAWSGTEPTCAAMNVNVGVRTAAALLDQFYEKRRLLIVSTPTA    281 - 350
RNLLYRLQLGMLQQAQCGLDLRHITVVELVGVFPTLIGRIGAKIMPPALALQLRLLLRIPLYSFSMVLVD    351 - 420
KHGMDKERYVSLVMPVALFNLIDTFPLRKEEMVLQAEMSQTCNT                              421 - 464
//

Text Mined References (19)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20406461 2010 Pelota interacts with HAX1, EIF3G and SRPX and the resulting protein complexes are associated with the actin cytoskeleton.
19862339 2009 ETX1 is over-expressed in the glaucomatous trabecular meshwork.
19424611 2009 Downregulation of drs tumor suppressor gene in highly malignant human pulmonary neuroendocrine tumors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15021917 2004 A novel apoptotic pathway induced by the drs tumor suppressor gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12874760 2003 Down-regulation of drs mRNA in human prostate carcinomas.
More...