Property Summary

NCBI Gene PubMed Count 17
Grant Count 43
R01 Count 20
Funding $3,407,067.09
PubMed Score 7.23
PubTator Score 787.13

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
20406461 PELO is subcellularly localized at the actin cytoskeleton, interacts with HAX1, EIF3G and SRPX proteins and that this interaction occurs at the cytoskeleton; this interaction may facilitate PELO to detect and degrade aberrant mRNAs.
19862339 This is the first report demonstrating overexpression of ETX1 in glaucomatous trabecular meshwork.
19424611 Downregulation of drs tumor suppressor gene in highly malignant human pulmonary neuroendocrine tumors.
15021917 An apoptosis-inducing protein localized in the endoplasmic reticulum which increases efficiency of apoptosis
12874760 Down-regulation of drs mRNA is closely correlated with development of prostate carcinoma, suggesting a tumor-suppressor function of the drs gene in this cancer.
12716466 down-regulation of drs mRNA is closely correlated with carcinomas which arise from adenomatous polyps in the course of the adenoma-carcinoma sequence, but most carcinomas arising de novo are independent of the tumor suppressor function of the drs gene
12152160 expression of drs mRNA in well-differentiated, moderately differentiated, and poorly differentiated lung adenocarcinoma tissues (drs; down-regulated by v-scr)
209648 The SRPX protein contains the P-DUDES structural domain in its C-terminal region. This domain has significant albeit remote sequence similarity to thioredoxin-like domains, and is predicted to possess an oxidoreductase function.

AA Sequence

MGSPAHRPALLLLLPPLLLLLLLRVPPSRSFPGSGDSPLEDDEVGYSHPRYKDTPWCSPIKVKYGDVYCR      1 - 70
APQGGYYKTALGTRCDIRCQKGYELHGSSLLICQSNKRWSDKVICKQKRCPTLAMPANGGFKCVDGAYFN     71 - 140
SRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPPRIKCPSVKERIAEPNKLTVRVSWETPEGRD    141 - 210
TADGILTDVILKGLPPGSNFPEGDHKIQYTVYDRAENKGTCKFRVKVRVKRCGKLNAPENGYMKCSSDGD    211 - 280
NYGATCEFSCIGGYELQGSPARVCQSNLAWSGTEPTCAAMNVNVGVRTAAALLDQFYEKRRLLIVSTPTA    281 - 350
RNLLYRLQLGMLQQAQCGLDLRHITVVELVGVFPTLIGRIGAKIMPPALALQLRLLLRIPLYSFSMVLVD    351 - 420
KHGMDKERYVSLVMPVALFNLIDTFPLRKEEMVLQAEMSQTCNT                              421 - 464
//

Text Mined References (19)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20406461 2010 Pelota interacts with HAX1, EIF3G and SRPX and the resulting protein complexes are associated with the actin cytoskeleton.
19862339 2009 ETX1 is over-expressed in the glaucomatous trabecular meshwork.
19424611 2009 Downregulation of drs tumor suppressor gene in highly malignant human pulmonary neuroendocrine tumors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15021917 2004 A novel apoptotic pathway induced by the drs tumor suppressor gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12874760 2003 Down-regulation of drs mRNA in human prostate carcinomas.
More...