Property Summary

NCBI Gene PubMed Count 29
PubMed Score 16.16
PubTator Score 9.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Synonym

Accession P78537 A1L4Q9 Q6NZ45 BLOC-1 subunit 1
Symbols RT14
BLOS1
MICoA
BORCS1
GCN5L1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (11)

AA Sequence

MAPGSRGERSSFRSRRGPGVPSPQPDVTMLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHL      1 - 70
NVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATAL     71 - 140
EYVYKGQLQSAPS                                                             141 - 153
//

Text Mined References (33)

PMID Year Title