Property Summary

Ligand Count 1,191
NCBI Gene PubMed Count 351
PubMed Score 3569.04
PubTator Score 889.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Acquired thrombocytopenia 8
Acute lymphoid leukemia 25
Adrenal cortical hypofunction 23
Adrenogenital disorder 6
Allergic bronchopulmonary aspergillosis 4
Allergic conjunctivitis 22
Allergic rhinitis 94
Angioedema 38
Ankylosing spondylitis 140
Articular gout 11
Aspiration pneumonitis 6
Asthma 385
Atopic dermatitis 952
Autoimmune disease 5
Autoimmune hemolytic anemia 31
Bacterial conjunctivitis 10
Bacterial keratitis 5
Berylliosis 28
Blepharoconjunctivitis 5
Bursitis 10
Cerebral Edema 30
Congenital adrenal hyperplasia 73
Congenital hypoplastic anemia 8
Contact Dermatitis 81
Corneal Ulcer 21
Corneal abrasion 5
Crohn's disease 321
Cyclitis 5
Dacryocystitis 11
Dermatitis herpetiformis 12
Diagnostic Test for Cushing's Syndrome 5
Discoid lupus erythematosus 7
Disorder of eye 27
Disorder of musculoskeletal system 5
Disorder of skin 5
Edema of larynx 5
Eosinophilic asthma 6
Epicondylitis 22
Eruption of skin 5
Erythema multiforme 17
Erythroblastic Anemia 5
Erythroderma 5
Exacerbation of asthma 11
Extrinsic allergic alveolitis 6
Fibrosis of lung 4
Follicular non-Hodgkin's lymphoma 17
Giant cell arteritis 7
Granuloma annulare 5
Herpes zoster keratitis 5
Hodgkin's disease 18
Humoral hypercalcemia of malignancy 6
Idiopathic thrombocytopenic purpura 5
Infective blepharitis 5
Inflammatory bowel disease 151
Iridocyclitis 19
Iritis 8
Juvenile rheumatoid arthritis 111
Keratitis 62
Lichen simplex chronicus 7
Löffler's syndrome 5
Meibomianitis 4
Miliary tuberculosis 6
Multiple Sclerosis 540
Mycosis fungoides 29
Nephrotic Syndrome 78
Non-Hodgkin's lymphoma 22
Ocular rosacea 4
Pemphigus 23
Plaque psoriasis 17
Pneumocystosis jiroveci pneumonia 7
Polymyalgia rheumatica 10
Post traumatic osteoarthritis 5
Post-Op Ocular Inflammation 9
Primary adrenocortical insufficiency 6
Primary cutaneous T-cell lymphoma 29
Progressive Diffuse Large B-Cell Lymphoma 4
Pruritus ani 14
Pruritus of genital organs 5
Psoriasis with arthropathy 11
Punctate keratopathy 5
Rheumatic heart disease 10
Rheumatoid arthritis 1191
Rosacea 25
Scalp psoriasis 6
Seborrheic dermatitis 31
Severe Ocular Inflammation 4
Severe adrenal insufficiency 5
Sjögren's syndrome 5
Stevens-Johnson syndrome 92
Superficial Ocular Infection 6
Sympathetic uveitis 4
Synovitis 78
Synovitis due to Osteoarthritis 5
Systemic Dermatomyositis 5
Systemic lupus erythematosus 194
Tendinitis 14
Tenosynovitis 14
Thyroiditis 29
Transfusion Reaction Urticaria 5
Transfusion reaction due to serum protein reaction 5
Transplanted organ rejection 10
Uveitis 103
psoriasis 6694
sarcoidosis 370
ulcerative colitis 1819
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (14)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 1.4e-04
atypical teratoid/rhabdoid tumor 1.200 8.5e-04
diabetes mellitus -1.100 1.4e-02
ependymoma 1.300 7.4e-06
glioblastoma 1.400 4.6e-05
group 3 medulloblastoma 1.200 2.5e-02
intraductal papillary-mucinous neoplasm ... 1.100 2.0e-02
lung cancer -1.200 1.3e-02
lung carcinoma -1.500 1.0e-21
osteosarcoma 2.357 4.0e-06
ovarian cancer 2.900 3.3e-08
pediatric high grade glioma 1.200 1.6e-03
primitive neuroectodermal tumor 1.100 5.0e-04
subependymal giant cell astrocytoma 1.201 2.8e-02

Protein-protein Interaction (2)

PDB (23)

Gene RIF (326)

AA Sequence

MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDLQTSTHVETLL      1 - 70
TFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRI     71 - 140
NTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVH    141 - 210
RVKRRADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIE    211 - 280
QIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGL    281 - 350
AYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGL    351 - 420
AECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGNSRVDEGEECD    421 - 490
PGIMYLNNDTCCNSDCTLKEGVQCSDRNSPCCKNCQFETAQKKCQEAINATCKGVSYCTGNSSECPPPGN    491 - 560
AEDDTVCLDLGKCKDGKCIPFCEREQQLESCACNETDNSCKVCCRDLSGRCVPYVDAEQKNLFLRKGKPC    561 - 630
TVGFCDMNGKCEKRVQDVIERFWDFIDQLSINTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVDKKLDK    631 - 700
QYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDS    701 - 770
HMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC                    771 - 824
//

Text Mined References (357)

PMID Year Title