Property Summary

NCBI Gene PubMed Count 325
Grant Count 372
R01 Count 256
Funding $40,797,771.41
PubMed Score 3251.43
PubTator Score 889.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (129)

Disease Z-score Confidence
Cancer 2,346 6.313 3.2
Portal vein thrombosis 9 5.628 2.8
Liver Cirrhosis 101 5.129 2.6
Hepatitis B 103 3.459 1.7
Hepatitis 61 3.44 1.7
Cholecystitis 8 3.282 1.6
Alzheimer's disease 644 3.032 1.5
Acquired thrombocytopenia 7
Acute lymphoid leukemia 25
Adrenal cortical hypofunction 7
Adrenogenital disorder 6
Allergic bronchopulmonary aspergillosis 4
Allergic conjunctivitis 25
Allergic rhinitis 91
Angioedema 36
Ankylosing spondylitis 138
Articular gout 11
Aspiration pneumonitis 6
Asthma 349
Atopic dermatitis 944
Autoimmune disease 5
Autoimmune hemolytic anemia 17
Bacterial conjunctivitis 10
Bacterial keratitis 5
Berylliosis 16
Blepharoconjunctivitis 5
Bulla 1
Bursitis 10
Cerebral edema 5
Colitis 46
Congenital adrenal hyperplasia 74
Congenital hypoplastic anemia 8
Contact Dermatitis 80
Corneal abrasion 6
Corneal ulcer 9
Crohn's disease 304
Cyclitis 6
Dacryocystitis 7
Dermatitis herpetiformis 11
Diagnostic Test for Cushing's Syndrome 5
Discoid lupus erythematosus 7
Disorder of eye 7
Disorder of musculoskeletal system 5
Disorder of skin 5
Edema of larynx 5
Eosinophilic asthma 5
Epicondylitis 19
Eruption of skin 5
Erythema multiforme 15
Erythroblastic Anemia 5
Erythroderma 5
Exacerbation of asthma 11
Extrinsic allergic alveolitis 6
Fibrosis of lung 4
Follicular non-Hodgkin's lymphoma 17
Giant cell arteritis 5
Granuloma annulare 5
Herpes zoster keratitis 6
Hodgkin's disease 18
Humoral hypercalcemia of malignancy 6
INFLAMMATORY SKIN AND BOWEL DISEASE, NEO... 1 
Idiopathic thrombocytopenic purpura 5
Infective blepharitis 5
Inflammatory bowel disease 142
Iridocyclitis 12
Iritis 9
Juvenile rheumatoid arthritis 104
Keratitis 42
Lichen simplex chronicus 7
Löffler's syndrome 5
Meibomianitis 4
Miliary tuberculosis 5
Multiple Sclerosis 498
Mycosis fungoides 28
Nephrotic Syndrome 48
Non-Hodgkin's lymphoma 22
Ocular rosacea 4
Pemphigus 18
Plaque psoriasis 14
Pneumocystosis jiroveci pneumonia 7
Polymyalgia rheumatica 10
Post traumatic osteoarthritis 5
Post-Op Ocular Inflammation 10
Primary adrenocortical insufficiency 6
Primary cutaneous T-cell lymphoma 24
Progressive Diffuse Large B-Cell Lymphom... 4 
Pruritus ani 14
Pruritus of genital organs 5
Psoriasis with arthropathy 11
Punctate Epithelial Keratopathy 6
Rheumatic heart disease 8
Rheumatoid Arthritis 1,160
Rosacea 18
Scalp psoriasis 6
Seborrheic dermatitis 19
Severe Ocular Inflammation 4
Severe adrenal insufficiency 5
Sjögren's syndrome 5
Stevens-Johnson syndrome 78
Superficial Ocular Infection 6
Sympathetic uveitis 4
Synovitis 38
Synovitis due to Osteoarthritis 5
Systemic Dermatomyositis 5
Tendinitis 13
Tenosynovitis 15
Thyroiditis 25
Transfusion Reaction Urticaria 5
Transfusion reaction due to serum protei... 5 
Transplanted organ rejection 10
Uveitis 103
atypical teratoid/rhabdoid tumor 1,095
diabetes mellitus 1,663
ependymoma 2,514
glioblastoma 5,572
group 3 medulloblastoma 2,254
intraductal papillary-mucinous neoplasm ... 3,289 
lung cancer 4,466
lung carcinoma 2,844
osteosarcoma 7,933
ovarian cancer 8,484
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
primitive neuroectodermal tumor 3,031
psoriasis 6,685
sarcoidosis 358
subependymal giant cell astrocytoma 2,287
systemic lupus erythematosus 156
ulcerative colitis 2,087

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma 2.357 0.000
ependymoma 1.300 0.000
glioblastoma 1.400 0.000
primitive neuroectodermal tumor 1.100 0.001
intraductal papillary-mucinous neoplasm ... 1.100 0.020
lung cancer -1.200 0.013
diabetes mellitus -1.100 0.014
pediatric high grade glioma 1.200 0.002
atypical teratoid/rhabdoid tumor 1.200 0.001
group 3 medulloblastoma 1.200 0.025
pilocytic astrocytoma 1.200 0.000
subependymal giant cell astrocytoma 1.751 0.007
lung carcinoma -1.500 0.000
ovarian cancer 2.900 0.000

Synonym

Accession P78536 O60226 ADAM 17
Symbols CSVP
TACE
NISBD
ADAM18
CD156B
NISBD1

Gene

PDB

1BKC   1ZXC   2A8H   2DDF   2FV5   2FV9   2I47   2M2F   2OI0   3B92   3CKI   3E8R   3EDZ   3EWJ   3G42   3KMC   3KME   3L0T   3L0V   3LE9   3LEA   3LGP   3O64  

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
720648 screening 3080 / 0 / 367196 QFRET-based biochemical primary high throughput screening assay to identify exosite inhibitors of ADAM17.
743013 summary 0 / 0 / 0 Summary of the probe development effort to identify exosite inhibitors of ADAM17.
743214 screening 10 / 0 / 2115 Counterscreen for exosite inhibitors of ADAM10: QFRET-based biochemical high throughput screening assay to identify inhibitors of ADAM17
743253 confirmatory 3 / 0 / 232 Counterscreen for exosite inhibitors of ADAM10: QFRET-based biochemical high throughput dose response assay to identify inhibitors of ADAM17
743257 screening 1855 / 0 / 1017 QFRET-based biochemical high throughput confirmation assay to identify exosite inhibitors of ADAM17
743260 confirmatory 5 / 0 / 243 QFRET-based biochemical high throughput dose response assay to identify exosite inhibitors of ADAM17

Gene RIF (301)

PMID Text
26744411 The effects of ADAM17 inhibition on the cancer stem cells phenotype and chemosensitivity to 5-fluorouracil (5-FU) in colorectal cancer cells were examined. siRNA knockdown and TAPI-2 decreased the protein levels of cleaved Notch1
26683521 Case Report: genetic deficiency of ADAM17 altering cytokine secretion and NK cell activity.
26617808 miR-338-3p is significantly decreased in gastric cancer, and inhibits cell proliferation, migration and invasion partially via the downregulation of ADAM17.
26535007 results explain how loss of the amino terminus in iRhom1 and iRhom2 impairs TNF signaling, despite enhancing ADAM17 activity
26422658 The production of ADAM17-positive microvesicless from smoke-exposed neutrophils provides a novel molecular mechanism for the vastly accelerated risk of AAA in smokers.
26359498 established that endogenous IL-6R of both human and murine origin is shed by ADAM17 in an induced manner, whereas constitutive release of endogenous IL-6R is largely mediated by ADAM10
26348730 The extracellular juxtamembrane segment of ADAM17, besides being involved in substrate recognition, is able to interact with lipid bilayers in vitro and this property could be involved in regulating ADAM17 shedding activity.
26338334 This study identifies TACE as an essential player in OL regeneration that may provide new insights in the development of new strategies for promoting myelin repair in demyelinating disorders.
26297956 Knockdown of ADAM17 elicited similar effects to that of miR-145 on NPC cells.
26250527 lower expression levels in the allergic nasal mucosa
More...

AA Sequence

MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDLQTSTHVETLL      1 - 70
TFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRI     71 - 140
NTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVH    141 - 210
RVKRRADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIE    211 - 280
QIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGL    281 - 350
AYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGL    351 - 420
AECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGNSRVDEGEECD    421 - 490
PGIMYLNNDTCCNSDCTLKEGVQCSDRNSPCCKNCQFETAQKKCQEAINATCKGVSYCTGNSSECPPPGN    491 - 560
AEDDTVCLDLGKCKDGKCIPFCEREQQLESCACNETDNSCKVCCRDLSGRCVPYVDAEQKNLFLRKGKPC    561 - 630
TVGFCDMNGKCEKRVQDVIERFWDFIDQLSINTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVDKKLDK    631 - 700
QYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDS    701 - 770
HMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC                    771 - 824
//

Text Mined References (331)

PMID Year Title
26744411 2016 A Disintegrin and Metalloproteinase Domain 17 Regulates Colorectal Cancer Stem Cells and Chemosensitivity Via Notch1 Signaling.
26683521 2015 Cytokine secretion and NK cell activity in human ADAM17 deficiency.
26617808 2015 MiR-338-3p inhibits the proliferation and migration of gastric cancer cells by targeting ADAM17.
26535007 2015 Deletions in the cytoplasmic domain of iRhom1 and iRhom2 promote shedding of the TNF receptor by the protease ADAM17.
26422658 2015 Proteolytically active ADAM10 and ADAM17 carried on membrane microvesicles in human abdominal aortic aneurysms.
26359498 2015 Shedding of Endogenous Interleukin-6 Receptor (IL-6R) Is Governed by A Disintegrin and Metalloproteinase (ADAM) Proteases while a Full-length IL-6R Isoform Localizes to Circulating Microvesicles.
26348730 2015 Extracellular Juxtamembrane Segment of ADAM17 Interacts with Membranes and Is Essential for Its Shedding Activity.
26338334 2015 Oligodendrocyte Regeneration and CNS Remyelination Require TACE/ADAM17.
26297956 2015 MiR-145, a microRNA targeting ADAM17, inhibits the invasion and migration of nasopharyngeal carcinoma cells.
26250527 2015 Expression profile of ADAM10 and ADAM17 in allergic rhinitis.
More...