Property Summary

NCBI Gene PubMed Count 164
PubMed Score 620.51
PubTator Score 381.69

Knowledge Summary


No data available


  Disease Sources (8)

Disease Target Count P-value
lung carcinoma 2844 8.63741255906956E-38
breast carcinoma 1614 4.50411542495074E-23
astrocytoma 1493 8.30690888380419E-13
oligodendroglioma 2849 5.18091049327392E-10
glioblastoma 5572 6.03508399966108E-9
pilocytic astrocytoma 3086 8.93762876931147E-7
posterior fossa group A ependymoma 1511 1.50708809896098E-5
colon cancer 1475 2.2366651056893E-5
adult high grade glioma 2148 4.18306670788642E-5
lung cancer 4473 4.2152356786932E-5
pituitary cancer 1972 7.12356118689535E-5
interstitial cystitis 2299 7.77560814490757E-5
invasive ductal carcinoma 2950 1.25166384171051E-4
atypical teratoid / rhabdoid tumor 4369 2.33758299041948E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.79316221551945E-4
ovarian cancer 8492 5.68280232920278E-4
psoriasis 6685 7.004730638714E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00430141804041171
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0055366967592762
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0079499170654999
subependymal giant cell astrocytoma 2287 0.00967244279710404
group 4 medulloblastoma 1875 0.0140802894704468
Breast cancer 3099 0.0370128747421083
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Kidney cancer 121 0.0 1.0
Disease Target Count Z-score Confidence
Lissencephaly 61 5.978 3.0
Epilepsy 346 4.407 2.2
Disease Target Count
Epilepsy, familial temporal lobe, 7 1



Accession P78509 A4D0P9 A4D0Q0 Q86UJ0 Q86UJ8 Q8NDV0 Q9UDQ2
Symbols RL


  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (158)

27071537 Reelin thus plays a role in restraining RAS and PI3-kinase promotion of cell motility and potentially tumour metastasis.
26978229 The features of reelin expression in the brain of fetuses and newborns at 22-40 weeks' gestation with internal HC should be considered as morphological differential and diagnostic criteria for the disease in relation to its etiology.
26523971 These findings suggest a central AKT-FOXG1-reelin signaling pathway in focal malformations of cortical development and support pathway inhibitors as potential treatments or therapies for some forms of focal epilepsy.
26455866 rs7341475 (A/G) and rs262355 (A/T) polymorphisms in RELN gene are inversely associated with SZ risk.
26384575 Among men, but not in women certain genotypes of the RELN gene were significantly associated with the susceptibility to Alzheimer's disease.
26317415 Report demonstrated that the reelin subregion R5-6 consisting of 747 amino acids in the 5th and 6th repeats was sufficient for apoER2 and VLDLR binding, and inhibiting lipoprotein-induced cholesterol accumulation in macrophages.
26305216 the reelin protein blood concentration might be a relevant signal with respect to the pathophysiology of schizophrenia.
26270645 Study shows that early neural cells transiently express Reelin at the time they leave the presumptive olfactory/vomeronasal epithelium and that Dab 1 is present in the migratory cell mass and in the presumptive ensheathing cells in the absence of reelin.
26046367 Heterozygous reelin mutations cause autosomal-dominant lateral temporal epilepsy.
25842846 RELN gene polymorphism rs7341475 C>T is associated with the risk of paranoid schizophrenia in Russians and Tatars.

AA Sequence

RKQNYMMNFSRQHGLRHFYNRRRRSLRRYP                                           3431 - 3460

Text Mined References (164)

PMID Year Title
27071537 2016 RAS signalling through PI3-Kinase controls cell migration via modulation of Reelin expression.
26978229 [Specific features of reelin expression in the brain of fetuses and newborns with internal hydrocephalus].
26523971 2015 An AKT3-FOXG1-reelin network underlies defective migration in human focal malformations of cortical development.
26455866 2015 Evaluating the relationship between reelin gene variants (rs7341475 and rs262355) and schizophrenia: A meta-analysis.
26384575 2015 Genetic analysis of the RELN gene: Gender specific association with Alzheimer's disease.
26317415 2015 A Subregion of Reelin Suppresses Lipoprotein-Induced Cholesterol Accumulation in Macrophages.
26305216 2015 Increased Blood-Reelin-Levels in First Episode Schizophrenia.
26270645 2015 Human Neural Cells Transiently Express Reelin during Olfactory Placode Development.
26046367 2015 Heterozygous reelin mutations cause autosomal-dominant lateral temporal epilepsy.
25842846 [The association of polymorphisms in SLC18A1, TPH1 and RELN genes with risk of paranoid schizophrenia].