Property Summary

NCBI Gene PubMed Count 67
Grant Count 77
R01 Count 61
Funding $11,510,604.44
PubMed Score 245.66
PubTator Score 128.01

Knowledge Summary

Patent (5,613)

Expression

Synonym

Accession P78508 A3KME7 Q5VUT9 Q8N4I7 Q92808
Symbols KIR1.2
KIR4.1
SESAME
BIRK-10
KCNJ13-PEN

Gene

Gene RIF (52)

PMID Text
27074084 Previous research had shown that Kir4.1 protein autoantibodies were specific for multiple sclerosis but they found that they weren't.
27074083 Previous research had shown that Kir4.1 protein autoantibodies were specific for multiple sclerosis but they found that they weren't.
25874548 This study identifies potential SNPs of KCNJ10 gene that may contribute to seizure susceptibility and anti-epileptic drug resistance.
25848073 disruption of cav-1 decreases basolateral K(+) channel activity and depolarizes the cell membrane potential in the DCT1 at least in part by suppressing the stimulatory effect of c-Src on Kcnj10
25392324 anti-KIR4.1 antibody levels differed in multiple sclerosis patients during relapse and remission; as such, they may represent a marker of disease exacerbation
25372295 KCNJ10 SNP is not associated with nonsyndromic enlargement of vestibular aqueduct in Chinese patients.
25008907 This study showed that rs2486253, but not rs61822012, polymorphism of KCNJ10 gene was associated with childhood idiopathic generalized epilepsy.
25008548 No KIR4.1-specific antigen is detected in serum or cerebrospinal fluid of multiple sclerosis (MS) patients; the target antigen of MS remains elusive.
24777949 This study observed a decrease of astroglial KIR4.1 but not glial fibrillary acidic protein IR. In chronic inactive and remyelinating MS lesions, KIR4.1 IR was restored on astrocytes and found in a subset of presumably new myelinating oligodendrocytes.
24756568 we confirmed the presence of anti-Kir4.1 antibodies in multiple sclerosis patients, but at a much lower prevalence than previously reported.
More...

AA Sequence

MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLL      1 - 70
FSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEEC     71 - 140
PLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIG    141 - 210
CQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELV    211 - 280
LILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYG    281 - 350
DPEKLKLEESLREQAEKEGSALSVRISNV                                             351 - 379
//

Text Mined References (67)

PMID Year Title
27074084 2016 Multiple Sclerosis and Antibodies against KIR4.1.
27074083 2016 Evaluation of KIR4.1 as an Immune Target in Multiple Sclerosis.
25874548 2015 Common variants of KCNJ10 are associated with susceptibility and anti-epileptic drug resistance in Chinese genetic generalized epilepsies.
25848073 2015 Caveolin-1 Deficiency Inhibits the Basolateral K+ Channels in the Distal Convoluted Tubule and Impairs Renal K+ and Mg2+ Transport.
25416956 2014 A proteome-scale map of the human interactome network.
25392324 2015 Increased anti-KIR4.1 antibodies in multiple sclerosis: could it be a marker of disease relapse?
25372295 2014 KCNJ10 may not be a contributor to nonsyndromic enlargement of vestibular aqueduct (NSEVA) in Chinese subjects.
25008907 2015 Contribution of KCNJ10 gene polymorphisms in childhood epilepsy.
25008548 2014 Investigation of the KIR4.1 potassium channel as a putative antigen in patients with multiple sclerosis: a comparative study.
24777949 2014 Differential loss of KIR4.1 immunoreactivity in multiple sclerosis lesions.
More...