Property Summary

NCBI Gene PubMed Count 68
PubMed Score 273.29
PubTator Score 128.01

Knowledge Summary

Patent (5,613)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 4.1e-04
atypical teratoid / rhabdoid tumor -4.000 3.5e-07
glioblastoma -1.400 3.2e-02
group 3 medulloblastoma -2.100 4.4e-03
interstitial cystitis 1.500 4.7e-02
medulloblastoma, large-cell -4.700 5.8e-08
oligodendroglioma 1.900 3.0e-03
posterior fossa group B ependymoma 1.200 5.9e-03
subependymal giant cell astrocytoma -1.754 4.3e-02

Gene RIF (53)

AA Sequence

MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLL      1 - 70
FSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEEC     71 - 140
PLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIG    141 - 210
CQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELV    211 - 280
LILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYG    281 - 350
DPEKLKLEESLREQAEKEGSALSVRISNV                                             351 - 379
//

Text Mined References (69)

PMID Year Title