Property Summary

NCBI Gene PubMed Count 215
Grant Count 379
R01 Count 228
Funding $35,808,802.94
PubMed Score 1096.75
PubTator Score 477.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (54)

Expression

Synonym

Accession P78504 A0AV43 B4DYR1 E9PCF9 O14902 O15122 Q15816 Jagged1
Symbols AGS
AHD
AWS
HJ1
AGS1
CD339
JAGL1

Gene

PDB

2KB9   2VJ2   4CBZ   4CC0   4CC1   4XI7   5BO1  

 GWAS Trait (1)

Gene RIF (180)

PMID Text
27487663 Expression of Jag-1 in dermal microvessels was enhanced from 20 weeks of gestation to 85 years.
26930648 SCC patients with higher JAG1 transcription had poor overall survival.
26926447 Immunohistochemical panel of CDX2, p120ctn, c-Myc, and Jagged1 proteins would be to distinguish between low/high grade dysplasia in histologically challenging cases of Barrett's esophagus.
26921446 bone marrow stroma induces Jagged1 expression in bone metastatic prostate cancer PC3 cells, and this enhanced expression is mechanistically linked to the promotion of cell migration
26779814 Jag1 is upregulated preferentially in pulmonary capillary endothelial cells in individuals with interstitial pulmonary fibrosis compared to normal lung.
26760175 Alagille syndrome type 1 patients have an increased risk of nonautoimmune hypothyroidism, and that variations in JAG1 gene can contribute to the pathogenesis of variable congenital thyroid defects.
26721293 Jagged1 expression was correlated with higher tumor grade and invasion of breast carcinomas.
26679605 Our collective results clearly indicate that miR-186 functions as a tumor suppressor in MM, supporting its potential as a therapeutic target for the disease.
26648562 these findings demonstrate that 50 microM EGCG protects against ox-LDL-induced endothelial dysfunction through the Jagged-1/Notch signaling pathway.
26646450 findings provide evidence for a novel cell-autonomous pro-inflammatory Jagged1-Notch1 pathway in endothelial cells
More...

AA Sequence

MRSPRTRGRSGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDE      1 - 70
CDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWD     71 - 140
SSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHY    141 - 210
ACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPW    211 - 280
QCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGS    281 - 350
CKETSLGFECECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP    351 - 420
CVNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYAGDHCERDIDE    421 - 490
CASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNRASDYFCKCPEDYEGKNC    491 - 560
SHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKGFTGTYCHENI    561 - 630
NDCESNPCRNGGTCIDGVNSYKCICSDGWEGAYCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGK    631 - 700
TCHSRDSQCDEATCNNGGTCYDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVC    701 - 770
KEGWEGPICAQNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN    771 - 840
GYRCVCPPGHSGAKCQEVSGRPCITMGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPRPCLLHKGHSE    841 - 910
CPSGQSCIPILDDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYYQDNCANITFTFNKEMMSPGLTTEHIC    911 - 980
SELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAEDIRDDGNPIKEITDKIIDLVSKRDGNSSLIA    981 - 1050
AVAEVRVQRRPLKNRTDFLVPLLSSVLTVAWICCLVTAFYWCLRKRRKPGSHTHSASEDNTTNNVREQLN   1051 - 1120
QIKNPIEKHGANTVPIKDYENKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNGTP   1121 - 1190
TKHPNWTNKQDNRDLESAQSLNRMEYIV                                             1191 - 1218
//

Text Mined References (219)

PMID Year Title
27487663 2016 [CHANGES OF THE CONTENT OF DLL4 AND Jag-1 ANGIOGENESIS REGULATORS IN HUMAN DERMIS IN ONTOGENESIS].
26930648 2016 JAG1 Is Associated with Poor Survival through Inducing Metastasis in Lung Cancer.
26926447 2016 Increasing diagnostic accuracy to grade dysplasia in Barrett's esophagus using an immunohistochemical panel for CDX2, p120ctn, c-Myc and Jagged1.
26921446 2016 Stroma-induced Jagged1 expression drives PC3 prostate cancer cell migration; disparate effects of RIP-generated proteolytic fragments on cell behaviour and Notch signaling.
26779814 2016 Targeting of the pulmonary capillary vascular niche promotes lung alveolar repair and ameliorates fibrosis.
26760175 2016 JAG1 Loss-Of-Function Variations as a Novel Predisposing Event in the Pathogenesis of Congenital Thyroid Defects.
26721293 2016 Potential Involvement of Jagged1 in Metastatic Progression of Human Breast Carcinomas.
26679605 2016 miR-186 inhibits cell proliferation in multiple myeloma by repressing Jagged1.
26648562 2016 EGCG attenuates atherosclerosis through the Jagged-1/Notch pathway.
26646450 2015 Activation of an endothelial Notch1-Jagged1 circuit induces VCAM1 expression, an effect amplified by interleukin-1?.
More...