Property Summary

NCBI Gene PubMed Count 17
Grant Count 87
R01 Count 41
Funding $18,626,880.85
PubMed Score 56.72
PubTator Score 42.27

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P78426
Symbols NKX6A
NKX6.1

Gene

Gene RIF (12)

PMID Text
25871618 study evaluated the potential use of NKX6-1 as a diagnostic marker for well-differentiated neuroendocrine tumors
25596704 a significant relationship was observed between NKX6.1 and EMT marker expression levels, and NKX6.1 knockdown inhibited cell invasion, and overexpression of NKX6.1 promotes cell proliferation in vitro.
24407576 NKX6-1 reveals wide variations in methylation levels in normal control samples of cervical adenocarcinomas.
23897760 Mice transplanted with NKX6.1-low cells remained hyperglycemic throughout the 5-month post-transplant period whereas diabetes was reversed in NKX6.1-high recipients within 3 months.
23863625 MAFA, MAFB, NKX6.1, and PDX1 activity provides a gauge of islet beta cell function, with loss of MAFA (and/or MAFB) representing an early indicator of beta cell inactivity
21985235 Smooth muscle cells expressing nestin and Nkx6.1 are the main cell population derived from culturing human spinal cord cells in adherent conditions with serum.
21108535 Data suggest that NKX6.1 activates immature pancreatic markers but not pancreatic hormone gene expression in human liver cells, and suggest a potential role for NKX6.1 in promoting PDX-1 reprogrammed maturation along a beta-cell-like lineage.
20106981 identified an NKX6.1 recognition sequence in the distal region of the HNF1alpha promoter and demonstrated specific binding of NKX6.1 in beta cells
18754095 Alterations of gastric NKX6.1 expression in Helicobacter pylori infection, incisural antralisation, and intestinal metaplasia.
18347054 overexpression of Nkx6.1 in islets caused an increase in the level of [(3)H]thymidine incorporation that was twice the control level, along with complete retention of glucose-stimulated insulin secretion
More...

AA Sequence

MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPAGPPSSSSSSSSSSSPSPPLGTHNPG      1 - 70
GLKPPATGGLSSLGSPPQQLSAATPHGINDILSRPSMPVASGAALPSASPSGSSSSSSSSASASSASAAA     71 - 140
AAAAAAAAAASSPAGLLAGLPRFSSLSPPPPPPGLYFSPSAAAVAAVGRYPKPLAELPGRTPIFWPGVMQ    141 - 210
SPPWRDARLACTPHQGSILLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQV    211 - 280
KVWFQNRRTKWRKKHAAEMATAKKKQDSETERLKGASENEEEDDDYNKPLDPNSDDEKITQLLKKHKSSS    281 - 350
GGGGGLLLHASEPESSS                                                         351 - 367
//

Text Mined References (19)

PMID Year Title
25871618 2015 NKX6-1 Is a Novel Immunohistochemical Marker for Pancreatic and Duodenal Neuroendocrine Tumors.
25596704 2015 Overexpression of NKX6.1 is closely associated with progressive features and predicts unfavorable prognosis in human primary hepatocellular carcinoma.
24407576 2014 High methylation rate of LMX1A, NKX6-1, PAX1, PTPRR, SOX1, and ZNF582 genes in cervical adenocarcinoma.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23897760 2013 Enrichment of human embryonic stem cell-derived NKX6.1-expressing pancreatic progenitor cells accelerates the maturation of insulin-secreting cells in vivo.
23863625 2013 Inactivation of specific ? cell transcription factors in type 2 diabetes.
21985235 2011 Isolation of mineralizing Nestin+ Nkx6.1+ vascular muscular cells from the adult human spinal cord.
21108535 2010 NKX6.1 promotes PDX-1-induced liver to pancreatic ?-cells reprogramming.
20106981 2010 Distinct regulation of hepatic nuclear factor 1alpha by NKX6.1 in pancreatic beta cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...