Property Summary

NCBI Gene PubMed Count 21
PubMed Score 62.80
PubTator Score 42.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
diabetes mellitus 1728 4.71 2.4
Hyperglycemia 137 3.171 1.6

Expression

Gene RIF (16)

AA Sequence

MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPAGPPSSSSSSSSSSSPSPPLGTHNPG      1 - 70
GLKPPATGGLSSLGSPPQQLSAATPHGINDILSRPSMPVASGAALPSASPSGSSSSSSSSASASSASAAA     71 - 140
AAAAAAAAAASSPAGLLAGLPRFSSLSPPPPPPGLYFSPSAAAVAAVGRYPKPLAELPGRTPIFWPGVMQ    141 - 210
SPPWRDARLACTPHQGSILLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQV    211 - 280
KVWFQNRRTKWRKKHAAEMATAKKKQDSETERLKGASENEEEDDDYNKPLDPNSDDEKITQLLKKHKSSS    281 - 350
GGGGGLLLHASEPESSS                                                         351 - 367
//

Text Mined References (23)

PMID Year Title